CAZyme Information: I314_01400-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIII
• CAZyme ID: I314_01400-t35_1-p1
• CAZy Family: GH109
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757		83087.86	4.2357

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiCA1873	6782	1296111	148	6634

• Gene Location: location=KN848891:172749-176005(+)

Full Sequence      

MSLFFSWAALFLLSLTTAQNITQTTSFSFSPTPVSTSVPSPTAPLDSIVPGQGNYPPVQA
LCAGGANVPFCPGILLQDVQLSGIFSDSKPTVGTLNETLSAWDALGGNVTIGEVETFVEQ
YFKGEGLELSQVQLQNFVEDPAILGNIADPVFKAWVKIVNGYWTLLARETNQSALCNGNC
VSSLIPLNYSMIVPGGRYREIYYWDSFWVLEGLLKSELYDYAWDLLQNFMDLIDIYGFLP
NGGRKYYLNRSQPPVFVQMIDAYIKTTNNVTILERALPVASAELQWWTNNRTSNFTSPFT
NQSRIITQYSVTNSAPRPEGYVEDFETVMGASPALNETEQAELYSQLASGAESGWDYSSR
WCEQPLLNTTDNYPALRTLNIKSIIPVDLLSLMAGDHALLANMYELYANNTGGEKYTDNE
KRSKRDGQSGDDTASKVAYHRQMAQEYRDSILDLCWDSEKSWFYDFNMTSSSRSDVFHPG
GAWPLWQNITPSEIAGNESAALSFVSGFRFLLGHYSGVPSVATLLFTGLNWDFPNAWPPH
AYTSIKAFETLGRMLPNASVLSNLTIPFHSVTKNQLGLSESELQPQPQSTIGNVSLNTET
SQDKPWPLALSIEFANRYLDAAFCSWYSTGGEISGLLTQLPLSDLNATGTYTAGQAGVMF
EKFNVTDTDAAGGGGEYTVQIGFGWTNGVALWAAGEYGQYIPAPTCPLIPILEVNATSGT
NTSDSSVYNATDEDRGPTASDTAKSASLFVGYRIPRK

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	87	553	1e-114	0.8513238289205702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	1.09e-100	102	698	30	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	3.40e-96	75	698	10	545	alpha,alpha-trehalase
224541	TreA	1.79e-61	182	691	152	546	Neutral trehalase [Carbohydrate transport and metabolism].
237326	treA	5.50e-53	159	691	123	530	alpha,alpha-trehalase TreA.
183934	treF	2.42e-51	75	699	62	548	alpha,alpha-trehalase TreF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV23702.1|GH37	0.0	1	757	1	757
KGB76251.2|GH37	0.0	1	757	1	762
AAW44482.2|GH37|3.2.1.28	0.0	1	757	1	761
AFR96750.2|GH37	0.0	1	757	1	762
AUB26705.1|GH37	0.0	1	757	1	762

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	2.21e-57	109	698	74	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	2.82e-56	109	698	74	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	4.24e-49	73	691	52	533	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	1.25e-48	159	691	89	496	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	1.33e-46	159	691	89	496	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	2.77e-99	64	706	47	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|A8J4S9|TREA_APIME	6.02e-84	70	703	46	574	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|P19813|TREA_RABIT	2.07e-80	70	705	33	557	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|P32358|TREA_BOMMO	1.11e-79	70	701	27	553	Trehalase OS=Bombyx mori OX=7091 PE=1 SV=1
sp|Q9JLT2|TREA_MOUSE	2.80e-79	70	705	30	555	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999757	CS pos: 18-19. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in I314_01400-t35_1-p1.