CAZyme Information: I314_00510-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIII
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIII
• CAZyme ID: I314_00510-t35_1-p1
• CAZy Family: CBM21
• CAZyme Description: polygalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474		53318.67	5.6847

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiCA1873	6782	1296111	148	6634

• Gene Location: location=KN848889:1321811-1323742(+)

Full Sequence      

MRSICLLVCALSSAVVQGSLFVLSESQGQKSISENHNIWPYRHEVFEFHPEHKDLSTGLV
RPLCVLHSLGEGADDSYNFEKAVHQCGRGGIVRLPDANYTISRPLDIYLSNSILDLHGWL
SFSTNISSWIENRMPLDFQNQSLAFVVRGHDYILEGNDKGGINGNGQVWYDYAKDYGNKF
GRPMSLAIKNSKNVIIKNFSILQPQFWASLIWGSENVYIKDFYVNATSYNPESASDQKNW
LQNTDGSDTYQSHNVTYENMVYQGGDDCVALKPNSTSITLRNVTCYGGTGIAFGSIAQYS
GVKDVIEDVFMEDIRLYPSNQCPAYQGVYFKSWLGYSIGQPPNGGGGGYGYCRNVTVKDV
YMEDIWHPLVVQSDLTYLTLDREKYADSGLFEWYDIHLKNFTGKALRNRIAWMSCSKLTP
CHDWTFEGIDIMPGKRDHPEIHYTCNNFVLGGNDGLNQCHPSNSKLETENGGTL

Enzyme Prediction     

No EC number prediction in I314_00510-t35_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	131	447	6.1e-62	0.7938461538461539

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.35e-22	160	448	61	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	3.86e-19	70	447	77	417	polygalacturonase ADPG
215426	PLN02793	4.53e-14	160	433	151	396	Probable polygalacturonase
215540	PLN03010	1.37e-13	70	466	56	409	polygalacturonase
178580	PLN03003	2.31e-13	153	421	116	347	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV21054.1|GH28	0.0	1	474	1	474
KGB77456.1|GH28	0.0	1	474	1	474
AUB28044.1|GH28	0.0	1	474	1	479
AFR97960.2|GH28	0.0	1	474	1	479
AAW42245.1|GH28	0.0	1	474	1	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	3.56e-19	60	403	15	330	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NJB0|RGXA_ASPFN	5.09e-114	64	431	31	412	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|Q2UP32|RGXA_ASPOR	5.09e-114	64	431	31	412	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|Q2EQQ2|RGXA_ASPNG	2.41e-109	64	452	32	433	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	4.81e-109	64	452	32	433	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|A2RAY7|RGXC_ASPNC	6.34e-63	63	459	29	423	Putative galacturan 1,4-alpha-galacturonidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000267	0.999718	CS pos: 18-19. Pr: 0.9687

TMHMM  Annotations     

There is no transmembrane helices in I314_00510-t35_1-p1.