CAZyme Information: I308_06628-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIV
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIV
• CAZyme ID: I308_06628-t35_1-p1
• CAZy Family: GT71
• CAZyme Description: glycoside hydrolase family 3 domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831		89932.77	5.1101

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiIND107	6843	1296105	147	6696

• Gene Location: location=KN848880:162696-165656(-)

Full Sequence      

MSGDFDIESIVDQLTLEEACALTHGQDFWRLNGVPRLGVPAGLKITDGPNGARGEDFVGG
CTSALFPAGSSLGASFDVKSAIKVGEALARECRSKSAVALLGPTVNIHRHPTGGRNFESY
SEDPYLSGVMASGYIQGLQGAGIASVTKHFVCNDSETDRRTVDIIVGEQALREIYLRPFQ
IAFERAGPRGIMTSYNKARYPGESQRLLESVVRGEWGVEDLTVMSDWWGTYSVRPAIMAG
LDLEMPDSFHRGNGKLLAAAQDDENLAKAVFDRARNVLRMIKRAGGYSLEPERPEVAEDI
PETRQLIREVGAEGMALLKNTGVLPLSPKTKTVVAGTYATVALAHGGGSASLDAHRKITP
AEGLREAMDEVVVVPGPVPYLYLPLPQSDVFSSSGGVGTCKVDFYNPGGNLVDSRTLTTT
FLTALDRYPKNLVAGWTAKMSFKLLPKTTGTHTLAVASPSSAKLSVNGQYVCETDPDPAR
RDDFMQLAFHKCCVNTTYTFEAGKEYDVVIDYVSTEELFYSTACALNGIRFGYLEYTDDD
AAIQSAVKIAEEVGTVVACVGHGSDYETEGFDRDDISLLGKQNAFVQALADSSAKVIVVV
FAGSPIAMPWLDAVEAVVYGWFPGQELGHSLADILTGKINPSGRLPVTFPKVIEDSPAFG
NFPGVNEIIKYEEGVFVGYRHYSSRQIPTLYPFGFGLSYTNFKVTDMALRGAESFGPGKK
IEISVKITNTGSTAGRHTVLLFAQPPAAEDRPTLSLVDFVKSLELKPQESQILTMAVGGE
AFSVWEGSEAGSWVVKEGKYSLQIRDNAEARPMQSAEVRIRQGWKWHGLHA

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	246	9.2e-53	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.57e-54	66	804	120	750	beta-glucosidase BglX.
224389	BglX	1.52e-52	26	370	47	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	5.64e-45	538	699	76	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.14e-29	36	280	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.46e-26	9	759	55	725	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB26217.1|GH3	0.0	108	831	3	728
AFR96312.2|GH3	0.0	108	831	3	728
KGB75246.2|GH3	0.0	1	663	1	623
KGB80091.3|GH3	1.13e-239	1	360	1	362
ABQ91838.1|GH3	4.80e-176	7	809	16	820

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.65e-130	5	829	4	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.25e-125	5	829	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.64e-104	6	804	4	653	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	8.58e-87	7	804	4	698	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	1.16e-85	11	804	9	648	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	5.50e-168	7	804	11	823	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	1.96e-167	7	808	2	799	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	4.37e-158	3	829	10	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	3.02e-154	6	824	5	835	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	3.02e-154	6	824	5	835	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999924	0.000133

TMHMM  Annotations     

There is no transmembrane helices in I308_06628-t35_1-p1.