CAZyme Information: I308_05620-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIV
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIV
• CAZyme ID: I308_05620-t35_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509	KN848871|CGC2	55038.36	8.8254

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiIND107	6843	1296105	147	6696

• Gene Location: location=KN848871:421778-423470(-)

Full Sequence      

MGNTPSHQQQPSRASPPNTDAPQRHPSLRIHMPRRHVSPQPSNPTSPSSGRPGSGSPRRR
KSLELPDLNKLSFTPAALTPAAPVPTTHTHTSHHLAPSTAAGHHARHSTCPPLPGTPTGA
PSPGSGSASGSGTGSSNRYWRDQLGGRASPLAGPNAVGAMSKLEPTLSSGSTESRGGIVG
SDVNPYFPDPYGVHDPSARNVKAIPIPIPGKDRTRDQPQIQQAAAQAQAQSKPSDLGAIV
PVQEEGLKDDGLVDVPIQWNGGGRNVYVAGTWDGGWAKRIKLRRSTHDFNTTIRLPPGQY
RLKFIVDDSWRCSKQISTAVDDDGTLVNWIEVEAPKTAEEIKAEWAMDSEPAAKEEDTDE
SQWTSEIPPALILYQYIEELPFRFHPDELSAFLKSVPYIPNVPAPPTLPRILDKVIVNND
SKRLWDSKDHKGQPGYQHAPPAGVDDNSMLAVPNHVVLNHLTASAIRNGTLGVGTTTRYR
KKYITTMFFRDQPAPNEHPANQPVPQSAH

Enzyme Prediction     

No EC number prediction in I308_05620-t35_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406865	AMPK1_CBM	1.33e-37	253	336	1	83	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
214973	AMPKBI	2.35e-26	358	490	2	98	5'-AMP-activated protein kinase beta subunit, interation domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologues Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain is sometimes found in proteins belonging to this family.
199889	E_set_AMPKbeta_like_N	4.47e-25	255	332	2	80	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
398422	AMPKBI	4.41e-22	403	490	1	68	5'-AMP-activated protein kinase beta subunit, interaction domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologs Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain (pfam02922) is sometimes found in proteins belonging to this family.
199892	E_set_Isoamylase_like_N	0.003	262	310	12	63	N-terminal Early set domain associated with the catalytic domain of isoamylase-like (also called glycogen 6-glucanohydrolase) proteins. E or "early" set domains are associated with the catalytic domain of isoamylase-like proteins at the N-terminal end. Isoamylase is one of the starch-debranching enzymes that catalyze the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen. Isoamylase contains a bound calcium ion, but this is not in the same position as the conserved calcium ion that has been reported in other alpha-amylase family enzymes. The N-terminal domain of isoamylase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and the beta subunit of AMP-activated protein kinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV22772.1|CBM48	0.0	1	509	1	509
AFR95838.1|CBM48	5.10e-300	1	509	1	509
AUB25695.1|CBM48	5.10e-300	1	509	1	509
UOH82189.1|CBM48	2.07e-299	1	509	1	509
AAW44123.1|CBM48	2.70e-281	1	509	1	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2QLV_B	2.58e-22	252	489	3	249	Crystal structure of the heterotrimer core of the S. cerevisiae AMPK homolog SNF1 [Saccharomyces cerevisiae],2QLV_E Crystal structure of the heterotrimer core of the S. cerevisiae AMPK homolog SNF1 [Saccharomyces cerevisiae]
4QFG_B	1.79e-20	258	490	17	202	Structure of AMPK in complex with STAUROSPORINE inhibitor and in the absence of a synthetic activator [Rattus norvegicus],4QFR_B Structure of AMPK in complex with Cl-A769662 activator and STAUROSPORINE inhibitor [Rattus norvegicus],4QFS_B Structure of AMPK in complex with Br2-A769662core activator and STAUROSPORINE inhibitor [Rattus norvegicus],5KQ5_B AMPK bound to allosteric activator [Rattus norvegicus],5UFU_B Structure of AMPK bound to activator [Rattus norvegicus]
6E4T_B	2.44e-20	258	490	17	202	Structure of AMPK bound to activator [Rattus norvegicus],6E4U_B Structure of AMPK bound to activator [Rattus norvegicus],6E4W_B Structure of AMPK bound to activator [Rattus norvegicus]
5T5T_B	2.44e-20	258	490	17	202	AMPK bound to allosteric activator [Rattus norvegicus]
6C9F_B	4.53e-20	258	490	17	202	AMP-activated protein kinase bound to pharmacological activator R734 [Homo sapiens],6C9G_B AMP-activated protein kinase bound to pharmacological activator R739 [Homo sapiens],6C9H_B non-phosphorylated AMP-activated protein kinase bound to pharmacological activator R734 [Homo sapiens],6C9J_B AMP-activated protein kinase bound to pharmacological activator R734 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78789|AAKB_SCHPO	4.71e-30	257	491	103	295	5'-AMP-activated protein kinase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=amk2 PE=1 SV=2
sp|P34164|SIP2_YEAST	5.71e-21	247	489	158	409	SNF1 protein kinase subunit beta-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIP2 PE=1 SV=3
sp|Q9R078|AAKB1_MOUSE	7.52e-20	258	490	83	268	5'-AMP-activated protein kinase subunit beta-1 OS=Mus musculus OX=10090 GN=Prkab1 PE=1 SV=2
sp|P80386|AAKB1_RAT	1.02e-19	258	490	83	268	5'-AMP-activated protein kinase subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Prkab1 PE=1 SV=4
sp|Q5BIS9|AAKB1_BOVIN	1.02e-19	258	490	83	268	5'-AMP-activated protein kinase subunit beta-1 OS=Bos taurus OX=9913 GN=PRKAB1 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I308_05620-t35_1-p1.