CAZyme Information: I308_05389-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIV
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIV
• CAZyme ID: I308_05389-t35_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249		27031.83	3.7346

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiIND107	6843	1296105	147	6696

• Gene Location: location=KN848870:355614-356691(+)

Full Sequence      

MQAIQDTKVNMTIWPAIYVDSNEAAYKDQLAAIVDALKTYGVDMVEGITVGNEYILNTAG
SDSTTSSAYTAALATIADKITEVNSTIQALGLSKKLPIGTSDAGSVMSKSLGEDVNYFMA
NVHPWFGALAIDDAATWTYEFFQEFDVQVGAEASNNPAMYIAETGWPTQSSNSSESNDGA
GSPQGDASVANLQTFLDTFVCQANANGTQYFYFEAFDEPWKEIYGGVEPWWGLFNFDREL
KNITIPTCN

Enzyme Prediction     

No EC number prediction in I308_05389-t35_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	22	241	1.6e-28	0.7717041800643086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	7.72e-24	8	238	102	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	9.79e-10	48	241	89	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV25740.1|GH17	6.15e-177	1	249	1	249
KGB79281.2|GH17	7.80e-171	1	249	249	497
UOH85421.1|GH17	7.75e-164	1	249	229	477
AAW47222.2|GH17	2.02e-163	1	249	247	495
AUB28743.1|GH17	8.44e-163	1	249	248	496

PDB Hits     

I308_05389-t35_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WUK5|BTGC_ASPFU	1.11e-37	10	248	447	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	1.11e-37	10	248	447	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|A1DEV5|BTGC_NEOFI	1.25e-35	10	248	447	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|A2QN74|BTGC_ASPNC	1.35e-33	10	248	443	678	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2
sp|A1CAI0|BTGC_ASPCL	1.90e-33	10	248	454	689	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I308_05389-t35_1-p1.