CAZyme Information: I308_04356-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIV
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIV
• CAZyme ID: I308_04356-t35_1-p1
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		44528.59	4.6589

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiIND107	6843	1296105	147	6696

• Gene Location: location=KN848866:77534-79025(+)

Full Sequence      

MQIGSLVPLLALLAAPAFARSSVHPNAAAHRRQDVAHERVNSAVERREALAETQPRALAE
KPKFKKITRRGARGCRAKNSTATASDSATASAPSGNSTVVASNSTDTNVTSTVTTQSPVG
NTSSSSESAAATASSIENLAALQQPSSSSSTGDSSTAASSTSVASAAATASSSSNSTGSY
TPNGIKAGISGDDPLSFLQGHIGWYYDWNASPSGSASGASPANMLWGAGSVDSTDASRLA
AFKALTSTPEYIIGFEEPDCSTPGSSNIAVADAASLWDSTIAPWKAKGSTLISPSMCHQA
AEQYTQWLAGFSGQISTSWDITNLHINKNSMDGVKADIDYYYTTYGKPIWVTEFACVDDS
TGFVPCTDQSEINTFINDIVDLFESDDRIQAYAYSTGEGLSSQWDMISNGALTESGQTYL
SAISKYH

Enzyme Prediction     

No EC number prediction in I308_04356-t35_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	199	419	3e-56	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	4.17e-62	188	419	4	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
PNP47955.1|GH128	8.75e-83	181	427	7	254
UKZ69748.1|GH128	2.79e-81	181	427	7	254
QYT06237.1|GH128	3.32e-81	181	427	23	270
UKZ58231.1|GH128	2.65e-80	181	427	23	270
UKZ94447.1|GH128	5.00e-79	179	427	5	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UBC_A	1.55e-199	21	427	22	444	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UBD_A	6.60e-84	181	427	29	276	Chain A, Glyco_hydro_cc domain-containing protein [Trichoderma gamsii]
6UAQ_A	1.66e-09	184	422	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	4.03e-09	184	422	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAS_A	9.76e-09	184	422	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	8.59e-12	196	421	312	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000804	0.999154	CS pos: 19-20. Pr: 0.9756

TMHMM  Annotations     

There is no transmembrane helices in I308_04356-t35_1-p1.