CAZyme Information: I308_03939-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIV
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIV
• CAZyme ID: I308_03939-t35_1-p1
• CAZy Family: PL38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556	KN848864|CGC3	59740.25	3.9103

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiIND107	6843	1296105	147	6696

• Gene Location: location=KN848864:499579-501741(-)

Full Sequence      

MYCALATLSLFALAVAAGSHNRRLDDHKRHYARMPLSGAYKTLPLPQNLYVETPTKRDEC
THGDWNCAGSELQRCNWGDWIAIQNCTGDNIVCSTQQDAVGCVWTWFVDSSATSQATTQP
TLPATTSLVFDANSAVSASDVSATGSDEPSGTTSTSSLYATATTTAAASDNDNQVDDGDD
DDDCEDETWASIPSTTSHDATITSSATFPISSAQDTLTFQIGDGLWAGNKSQTRQWADNG
ASTASITGPNVSVSYAAATASSTTATPSTDSTPTQMSEWPAPHYVIYADSWLGTMPDVSE
LGYFNRFILAFWEATAGAVDNVQAWTSWDESYRSQVVEAYHDAGIAIMVAAFGSTDLPTT
SGRDAKQVAQELASFVKAYNLDGVDIDYEDMSAVNSAHAVAWIVEFQKELRNLLPLPYII
SHAPVAPWFTSANDYADGAYVSIHQQVGDTIDFYNVQFYNQGADQYVTCETLLTNSGSEW
PSTSVFEINSYTGVPLDKIVIGKPLGVDSASNGYMSASDLQVCVGEAEEEGWKGGIMFWQ
WSDEAPSVMATARGCA

Enzyme Prediction     

No EC number prediction in I308_03939-t35_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119349	GH18_chitinase-like	1.61e-28	284	542	4	208	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119350	GH18_chitinase_D-like	4.76e-17	351	539	83	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
226000	Chi1	5.13e-12	295	543	20	308	Chitinase [Carbohydrate transport and metabolism].
395573	Glyco_hydro_18	1.35e-11	364	513	88	230	Glycosyl hydrolases family 18.
119363	GH18_CTS3_chitinase	4.88e-11	326	541	60	253	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV22450.1|GH18	0.0	1	556	1	552
KGB77976.2|GH18	7.71e-297	1	556	1	629
AAW43533.1|GH18	1.92e-264	1	554	1	582
AFR95478.1|GH18	5.73e-250	1	554	1	634
AUB25287.1|GH18	5.73e-250	1	554	1	634

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K7Z_A	2.90e-21	285	544	5	265	Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_B Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_C Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_D Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia]
4W5Z_A	3.45e-11	337	539	101	311	High resolution crystal structure of catalytic domain of Chitinase 60 from psychrophilic bacteria Moritella marina. [Moritella marina]
4HMC_A	6.59e-11	337	539	79	289	Crystal structure of cold-adapted chitinase from Moritella marina [Moritella marina],4HMD_A Crystal structure of cold-adapted chitinase from Moritella marina with a reaction intermediate - oxazolinium ion (NGO) [Moritella marina],4HME_A Crystal structure of cold-adapted chitinase from Moritella marina with a reaction product - NAG2 [Moritella marina]
4MB3_A	1.52e-10	337	539	79	289	Crystal structure of E153Q mutant of cold-adapted chitinase from Moritella marina [Moritella marina],4MB4_A Crystal structure of E153Q mutant of cold-adapted chitinase from Moritella complex with Nag4 [Moritella marina],4MB5_A Crystal structure of E153Q mutant of cold-adapted chitinase from Moritella complex with Nag5 [Moritella marina]
4RL3_A	6.78e-08	306	468	29	198	Crystal Structure of the Catalytic Domain of a family GH18 Chitinase from fern, Peteris ryukyuensis [Pteris ryukyuensis],4RL3_B Crystal Structure of the Catalytic Domain of a family GH18 Chitinase from fern, Peteris ryukyuensis [Pteris ryukyuensis]

Swiss-Prot Hits     

I308_03939-t35_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000394	0.999555	CS pos: 16-17. Pr: 0.9526

TMHMM  Annotations     

There is no transmembrane helices in I308_03939-t35_1-p1.