CAZyme Information: I308_02960-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIV
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIV
• CAZyme ID: I308_02960-t35_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
154		16883.96	4.2214

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiIND107	6843	1296105	147	6696

• Gene Location: location=KN848861:387749-388463(-)

Full Sequence      

MVAILTLLSLLLTSTFIASAPSSATTEVQDPPPGNGRRIRPIWAPLQLWNVSNDSNGPIP
LQSKIGDMCLSAGDNPVSGSRLTIDHCGNGQKQTWNYSAQNKIQLDSTDLCLDVKEGSGP
INQNPYVIVKELQVWECEDDNNNQIFFELPYPNT

Enzyme Prediction     

No EC number prediction in I308_02960-t35_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	45	146	1e-17	0.4946808510638298

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	5.57e-11	47	146	38	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	2.90e-10	61	146	5	82	Ricin-type beta-trefoil lectin domain.
214672	RICIN	7.59e-07	47	148	31	118	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
238092	RICIN	9.88e-07	47	146	36	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
238092	RICIN	2.71e-06	67	146	10	80	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV19711.1|CBM13	8.47e-110	1	154	1	154
KGB75523.1|CBM13	2.45e-100	1	154	1	185
AFR92717.1|CBM13	3.56e-93	1	153	1	184
AUB22179.1|CBM13	3.56e-93	1	153	1	184
UOH79547.1|CBM13	6.39e-92	1	153	1	184

PDB Hits     

I308_02960-t35_1-p1 has no PDB hit.

Swiss-Prot Hits     

I308_02960-t35_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000405	0.999585	CS pos: 19-20. Pr: 0.9637

TMHMM  Annotations     

There is no transmembrane helices in I308_02960-t35_1-p1.