CAZyme Information: I308_02798-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIV
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIV
• CAZyme ID: I308_02798-t35_1-p1
• CAZy Family: GH18
• CAZyme Description: polygalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	KN848860|CGC1	53322.70	5.2484

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiIND107	6843	1296105	147	6696

• Gene Location: location=KN848860:783092-785025(-)

Full Sequence      

MRFICLFVCALSSAVVQGSLFVLSESQSQKSISEIDNIWPYPHEVFEFHPEHKDLSTGLV
RPLCVLHSLGEGADDSYNFEKAVHQCGRGGIVRLPDANYTISRPLDIYLSNSILDLHGWL
SFSTNISSWIENRMPLDFQNQSLAFVVRGNDYILEGNDKGGINGNGQVWYDYAKDYGNKF
GRPMSLAIKNSKNVIIKNFSIVQPQFWASLIWGSENVYIKDFYVNATSYNPESASDQKNW
LQNTDGSDTYQSHNVTYENMVYQGGDDCVALKPNSTSITLRNVTCYGGTGIAFGSIAQYS
GVKDVIEDVFMEDIRLYPSNQCPAYQGVYFKSWLGYSIGQPPNGGGGGYGYCRNVTVKDV
YMENIWHPLVVQSDLTYLTLDREKYADSGLFEWYDIHLKNFTGKALRNRIAWMSCSKLTP
CHDWTFEGIDIMPGKRDHPEIHYTCNNFVLGGNDGLNQCHPSNSKLETENGGTL

Enzyme Prediction     

No EC number prediction in I308_02798-t35_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	131	447	8.4e-62	0.7938461538461539

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	3.51e-22	160	448	61	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	2.07e-20	70	447	77	417	polygalacturonase ADPG
215426	PLN02793	3.46e-15	160	433	151	396	Probable polygalacturonase
215540	PLN03010	3.16e-14	70	466	56	409	polygalacturonase
178580	PLN03003	6.29e-14	153	421	116	347	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV21054.1|GH28	0.0	1	474	1	474
KGB77456.1|GH28	0.0	1	474	1	474
AAW42245.1|GH28	0.0	1	474	1	478
AUB28044.1|GH28	0.0	1	474	1	479
AFR97960.2|GH28	0.0	1	474	1	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	1.97e-19	61	403	16	330	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NJB0|RGXA_ASPFN	9.18e-112	64	431	31	412	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|Q2UP32|RGXA_ASPOR	9.18e-112	64	431	31	412	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|Q2EQQ2|RGXA_ASPNG	4.31e-107	64	452	32	433	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	8.61e-107	64	452	32	433	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|A2QG68|RGXB_ASPNC	1.91e-63	57	457	27	414	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000268	0.999697	CS pos: 18-19. Pr: 0.9679

TMHMM  Annotations     

There is no transmembrane helices in I308_02798-t35_1-p1.