CAZyme Information: I308_02292-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIV
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIV
• CAZyme ID: I308_02292-t35_1-p1
• CAZy Family: GH16
• CAZyme Description: GPI mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425	KN848859|CGC2	47498.96	9.3943

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiIND107	6843	1296105	147	6696

• Gene Location: location=KN848859:552999-554446(+)

Full Sequence      

MVKLSPLALIFIAACFSRILHLTVLSGLSKALPLFDTSPSLLLPSPPPSLRWDAIHFSSI
AYNGYEYEQQVAFQPGWLAVMRLAGEGVRFIRAASVVELKDVILGSTIMANFAFVAATLV
LYKLTKHIFNPTFALLTSLLYLLPPTATPSAPYTEPIYSLLTFSGIYLLSIKRQMVLAGL
CFAGATTVRSTGIFNLITLTCFAVFGDAHMLDLSDKDYAKRMTRKTWKHYLPALLVVAPF
IMFQYYCETVFCTRESKLANSARPWCSNSPPVSYGFVQKLYWNVGPFEYWTLAQLPNIAL
AMPILSFSLVGFVKYFSHLVSSSQVLNHGTGEKPPPPILFELYSVHLLTMALLLFTSHTQ
IALRVCLGDPVVWWNAVKLGFDNVEMDEGRKRHVKMNKFGRYWVGWTVVWGAIAAVLWAG
HYPPA

Enzyme Prediction     

No EC number prediction in I308_02292-t35_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	48	425	3.1e-98	0.8722358722358723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.35e-31	52	425	60	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	5.93e-10	51	374	76	361	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV21212.1|GT76	1.17e-306	1	425	1	425
KGB77682.1|GT76	1.45e-279	1	425	1	423
UOH80020.1|GT76	8.52e-269	1	425	1	420
AFR93820.1|GT76	4.92e-268	1	425	1	420
AUB23397.1|GT76	4.92e-268	1	425	1	420

PDB Hits     

I308_02292-t35_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP63|GPI18_CRYNB	8.03e-268	1	425	1	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1
sp|P0CP62|GPI18_CRYNJ	8.03e-268	1	425	1	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	2.06e-32	35	425	29	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	2.97e-28	22	425	33	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q5KR61|PIGV_RAT	8.06e-27	51	374	65	415	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.605489	0.394508

TMHMM  Annotations     

Start	End
7	29
102	121
128	147
152	171
192	211
231	253
298	320
335	357
399	421