CAZyme Information: I308_01672-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIV
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIV
• CAZyme ID: I308_01672-t35_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470	KN848858|CGC1	52481.58	5.3663

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiIND107	6843	1296105	147	6696

• Gene Location: location=KN848858:232846-234530(-)

Full Sequence      

MFSLGAFITTTICLLSHLPTALAFGVQNYPNLFFDASAVVSNQWFNGVDSRWAREMSEHW
AQTLIHYGPWSVTNKSYTAKSGDKKDYLSWAVYHWPNCSNVQNTTELTQEEVWDQCDYVV
RDGQLNPDIELVKDKEALQNMSNSVYLSAMAYLHTNDSQYTTHINHALHTFFINNDTRMN
PNLNYAQVIRGPGDQMGRHTGVLDLACMAKIASGVQVMRSVKPAQWQQETETGIMQWASE
QLDWLYTSEQGLGELNATNNHGTFAVNQVCALNVLLNQNDACVTALEDFYNGIYMDQITA
NGDQPLESARTRPYHYRAFNLMALVTNAQFGDFVGLSPSAWERRSAANTTLIDALHYAML
QNYTASNELTQGRALNPVVAAVSAKYGDPDNKYANFLKSADPYFPGQPWFALNEGLSDAG
IKQGLLETTYGPVPPQPTLRAGSPDDPGYQRKRDWKPRGTGWPTAAPKAP

Enzyme Prediction     

No EC number prediction in I308_01672-t35_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	72	359	1e-87	0.96415770609319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	1.61e-71	71	359	1	265	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
234727	algL	0.005	255	331	190	265	polysaccharide lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV20174.1|PL38	0.0	1	470	1	470
KGB74556.1|PL38	0.0	1	470	1	470
AAW40805.1|PL38	2.51e-313	1	470	3	472
AFR92301.1|PL38	1.09e-307	1	470	3	472
AUB21714.1|PL38	1.09e-307	1	470	3	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	3.35e-26	61	321	37	282	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

I308_01672-t35_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004035	0.995955	CS pos: 23-24. Pr: 0.9604

TMHMM  Annotations     

There is no transmembrane helices in I308_01672-t35_1-p1.