CAZyme Information: I308_01667-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIV
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIV
• CAZyme ID: I308_01667-t35_1-p1
• CAZy Family: PL38
• CAZyme Description: glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642		71945.41	4.5086

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiIND107	6843	1296105	147	6696

• Gene Location: location=KN848858:218961-221279(-)

Full Sequence      

MLSLLSSRYTRYLPLLLLVLLGTTFLLFERSSSASSTLPRSSVYDYTSPATHCFWPGTDT
NDESAAVSDSKIPANKDSVGKMKEWMGWGDSEEVDEDVPSAEAFAWEGQLPDVVPVSGIE
RYMLAHIEELQQGYDAKHDYEEYGLKLGNISLSAYTAELLETYKEYLLPPGTPPPNPPPS
FLPTVLSRLSLRPPITPLPPRPDQVMTTEKSVDDLPWQFQRWKEIMPEWEIKYFDDKALK
NWVKGMFGGTKAEEIWMNLPRQVLKTDVFRYMAMLVEGGIYTDSDTAPIIHADQWGHPYN
HRTSPLLTHLSRILSIATSPHLPSSHPLSSFSPDHAGTTIDEELDVGISTGKSNIYDGPL
VDDGAELGQPSLVVSVESDAIDFGWHNWREVGLSRAVQITQWTFMARPGHPVFLDALGRT
LRKSEEMARKEKEANKNGKEFIPETALEWTGPGVFSDCVYRYLIARYGFKPEDLIHKKDP
LRVGDVLILPAGSYSSVSPFGDEQQRNWAASWHGFFGRWRGADPGVQEFERLKKLKKEAE
EAEKKAKEEAEEAEREAKEAEQKAKEAYDQADKSAQEAEEKAKEAAEEAGRKAQEASDTV
EALEEEVEKAKEAAVGISDGQDNGSGDFTEIREETEEEKMSA

Enzyme Prediction     

No EC number prediction in I308_01667-t35_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	2.14e-05	218	296	7	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	1.27e-04	211	419	91	242	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB74562.2|GT32	0.0	1	642	1	642
ADV20178.1|GT32	0.0	1	642	1	642
AFR92295.1|GT32	0.0	1	641	1	641
AUB21707.1|GT32	0.0	1	641	1	641
AAW40799.1|GT32	0.0	1	640	1	639

PDB Hits     

I308_01667-t35_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	5.12e-24	222	520	165	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	3.81e-15	184	531	82	385	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	2.51e-12	187	516	82	404	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	8.87e-09	254	495	187	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.983363	0.016653

TMHMM  Annotations     

Start	End
12	29