CAZyme Information: I308_00933-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIV
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIV
• CAZyme ID: I308_00933-t35_1-p1
• CAZy Family: CE17
• CAZyme Description: endo alpha-1,4 polygalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	KN848856|CGC3	37957.66	3.9072

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiIND107	6843	1296105	147	6696

• Gene Location: location=KN848856:856059-857549(-)

Full Sequence      

MILISPSSWLLVVSSLVAVTAAKPFPRNVHHQHCGLSFSVPMVETSVDATSPEETASTVN
SLNIETALASATNSNNAATASSSSTVTSASLSSTFVYELDAQSVTSPEITTDTGLVVNAG
VYIVYGEGTSEDTIAQYHADGKTVICYFSAGTWEPNRSDSGNFDSVCVCGPGGSFAGDVC
SSNENKLSGWNEWWLDIHSASCISNVESIMSARISSFKAKGCDGVDPDNVDSFANSDQLH
GNTADDQVNYLLWLSSTARSEGLMIDLKNAGSLLVEDNGEATSYQSEIIEAFDFAVIESC
HEYDECNIYDTFLAAGKPQIQIGYGDITTCPSLQDGQHLLVYSRNSLSSALITLECD

Enzyme Prediction     

No EC number prediction in I308_00933-t35_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	115	324	5.2e-60	0.9421052631578948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	7.94e-65	95	345	2	218	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	2.11e-11	133	306	94	248	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV23543.1|GH114	3.54e-221	1	357	1	357
KGB76338.2|GH114	1.09e-220	1	357	1	359
AFR96657.1|GH114	5.71e-195	1	357	1	358
AUB26602.1|GH114	5.71e-195	1	357	1	358
ALO69276.1|GH114	8.41e-195	1	357	1	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	2.91e-25	117	328	55	238	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	4.01e-25	117	328	72	255	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

I308_00933-t35_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000250	0.999728	CS pos: 22-23. Pr: 0.7354

TMHMM  Annotations     

There is no transmembrane helices in I308_00933-t35_1-p1.