CAZyme Information: I308_00059-t35_1-p1

Basic Information

• Species: Cryptococcus gattii VGIV
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGIV
• CAZyme ID: I308_00059-t35_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		41313.17	7.3878

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiIND107	6843	1296105	147	6696

• Gene Location: location=KN848855:146286-147664(+)

Full Sequence      

MSLKVPNRPAEILTPFPRPDPSPEGLKILRQICRKAVESDEVYSVTFSDFLCPEGKNHLF
TLKPYFWEVEPGKWDCDKPGGQKQLETAATTIHNLALGAAYLPEFRDRCVQRLEQILNVF
FIDPETRMVPEVWYAQCNPGSKPLKGDFAFEIALRNIILVDQGMRLAASFLNKRTVDNLV
NWIATQAKWIRDSDQGAAARKYEDNKRIWLEAITASHLSFISPPEGNSYATSFFQTYATS
HPPKKFFEHELQRTRPRHYTLFALEPLFILAELTLPSSRRLDGHIAEYLRDLLGFAKLVA
PGEIERPLEEQGRYERRWQWYERMLAGWTGQGERGGDGPDGKAWDGGFTQRMRMIWGFI

Enzyme Prediction     

No EC number prediction in I308_00059-t35_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	83	274	3.3e-26	0.6845878136200717

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	2.01e-14	68	273	41	238	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDT67881.1|PL38	3.79e-18	26	264	44	298
UNE47223.1|PL38	4.01e-13	23	273	83	349
ATC32744.1|PL38	9.13e-13	42	273	84	330
UAL11661.1|PL38	1.23e-12	42	273	86	332
AZS22335.1|PL38	2.18e-12	42	273	81	327

PDB Hits     

I308_00059-t35_1-p1 has no PDB hit.

Swiss-Prot Hits     

I308_00059-t35_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I308_00059-t35_1-p1.