CAZyme Information: I306_06832-t38_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: I306_06832-t38_1-p1
• CAZy Family: PL4
• CAZyme Description: transglycosylase SLT domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400		42019.00	5.9211

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiEJB2	6908	1296103	145	6763

• Gene Location: location=KN848812:11756-13222(-)

Full Sequence      

MFANSLSLITALLPLLALTAQAAAAHSNQPPHLRHKRVLHHRRDTEHSHPHAARAQLPPR
SNAGHADAKKLIKKSVKKRGQTCRTRGSSYATSSAYDVAAAQTLSSSSYVEPTSSSTAWS
DDSSSSSYAAAATPVAATLSNEQAWAPQVISSSNEWSESTTADSWSSSATSSSAWTQPTS
SFSSGSSSGSSSSGLLTITDAICGYSNADSEIPNGSEDWLNCGLNAAGWTPPMVTVDELI
ASELTTDGVFAPCADYVDLFNQYADQYGLKGIMLASFAMQESTCNPSATGGNGEAGLMQL
ASENCGGAPNGNCYDVNFNIQRAAELFSNLISSNGGNVLLAIGSYNGWYSGLTYAAGTAA
ASQGQCHAQNNLDYIHQFCNGWMQNKSGYTLGTYFNLKSC

Enzyme Prediction     

No EC number prediction in I306_06832-t38_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396169	SLT	1.94e-11	260	347	1	94	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
381604	Slt70-like	3.91e-08	256	347	6	106	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
223812	MltE	1.23e-07	255	364	138	256	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
381594	LT-like	4.16e-07	273	347	3	80	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
381606	MLTF-like	1.36e-06	260	346	1	93	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV24528.1|GH23	3.05e-262	1	400	1	400
KNX49777.2|GH23	5.82e-226	1	400	1	402
AAW46053.1|GH23	3.98e-212	1	400	1	401
AFR97355.1|GH23	2.35e-208	1	400	1	399
AUB27369.1|GH23	2.35e-208	1	400	1	399

PDB Hits     

I306_06832-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

I306_06832-t38_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000958	0.999009	CS pos: 22-23. Pr: 0.9723

TMHMM  Annotations     

There is no transmembrane helices in I306_06832-t38_1-p1.