CAZyme Information: I306_05180-t38_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: I306_05180-t38_1-p1
• CAZy Family: GT22
• CAZyme Description: mannosyl-oligosaccharide 1,2-alpha-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
864	KN848736|CGC2	97155.59	5.9631

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiEJB2	6908	1296103	145	6763

• Gene Location: location=KN848736:359256-362134(-)

Full Sequence      

MGRSLSPKPTGRTMPYTPAYPSSSSDPEKGLPASPSSLARHMLVPRKPRWILGGLFICGV
VLYYMNSNRHEKTWGPGGSWDAEGDDSMAGWEPTDDKNEPLIYSDYIVDDQGNHFIKGWQ
QPITPIHPDVDLLPRAPSIFPYLNVSESEQPEEKIFPESDLRQIISEPPELPEEQSNSMP
EGTWSQKWSGPEVWDQPRREMKRVQWEGFAGGRDRWESENERKVREERKDAVKRGFKHAW
EAYKRHAWGHDEIRPVSLTASDPFNGWGATIVDSLDTLLLMGFSNEYNLCRPHINQLNFH
WVNGRDWSAGYVSEDLSGSGEVFALNRDKSVRLPVFETGIRYLGGLLGAYDLSGDDLLLE
RAIDLANVLSTAFKTGSGLPIGRVDPGTKDEMIRLGTVSLAEVGSMSLELIRLAQITKDR
KWFDLAQRAMDYIHERVIPRGTHSPLVPMWFQPDAPLNTPMNGGLTFGGLADSYYEYLIK
TYKLLGASEVSQVWRDVYERSIDKAKEILYVDIDIVPGRDILAVGKLENGRLIPELEHLT
CFIGAMLGLGAKLLNRPGDMRDAERVTASCYWLSADTPTGLQPEVVEWYAPHETSVMYEN
VSISGGGKYHPLVYNEKVFKGRDGMHRDRNGVLRWNEDNEPVLFADREKKKDPETPIKYG
QRLKGTPTGARKVSTRGLNRPETIESIFYMYRITGDRKWQEKGWKMFTSWMNTSTVDGGF
SSVEDVTVSPVRFSDNMESFALAETFKYHFLLQSEPDVLSLDNYVLNTEAHPFLTNPKLD
PKAHTSHTRFWSPPSSQDLGVRAQGTNVQKYARLEVIERASSPFRPPPPQNAPGGGGGRG
MGGGGGKPGVIPELPPEVLKNRIN

Enzyme Prediction     

No EC number prediction in I306_05180-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	236	773	2.9e-144	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.63e-179	236	773	2	451	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	3.88e-117	172	778	21	521	glycoside hydrolase family 47 protein; Provisional
271199	LanC_SerThrkinase	0.005	345	447	94	189	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
271200	LanM-like	0.007	343	432	598	682	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV23425.1|GH47	0.0	1	864	1	864
KGB76513.2|GH47	0.0	14	864	1	851
AFR96466.2|GH47	0.0	1	864	1	865
AUB26389.1|GH47	0.0	1	864	1	865
UOH82871.1|GH47	0.0	14	864	1	851

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	7.61e-72	236	772	13	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	8.93e-72	236	772	18	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	9.41e-72	236	772	18	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KK7_A	4.22e-71	236	772	13	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1X9D_A	6.70e-71	236	772	96	531	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UKM7|MA1B1_HUMAN	1.04e-68	236	772	257	692	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|B2GUY0|MA1B1_RAT	3.54e-65	227	772	206	650	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|Q8H116|MNS2_ARATH	1.55e-64	227	780	97	542	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|A2AJ15|MA1B1_MOUSE	4.57e-64	227	772	207	651	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
sp|Q9C512|MNS1_ARATH	1.12e-63	224	785	93	546	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999963	0.000029

TMHMM  Annotations     

There is no transmembrane helices in I306_05180-t38_1-p1.