CAZyme Information: I306_04831-t38_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: I306_04831-t38_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249	KN848722|CGC1	26977.64	3.5928

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiEJB2	6908	1296103	145	6763

• Gene Location: location=KN848722:176559-177631(-)

Full Sequence      

MQAIQDTKVNMTIWPAIYVDSNEAAYTDQLAAIVDALKTYGVDMVEGITVGNEYILNTAG
SDSTTSSAYTAALATIADKVTEVNSTIQALGLSKNLPIGTSDAGSVMSKSLGEDVNYFMA
NVHPWFGALAIDDAATWTYEFFQEFDVQVGAEASNDPAMYIAETGWPTQSSNSSESNDGA
GSPQGDASVANLQTFLDTFVCQANANGTQYFYFEAFDEPWKEIYGGVEPWWGLFNFDREL
KNITIPTCN

Enzyme Prediction     

No EC number prediction in I306_04831-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	23	241	2.8e-28	0.7684887459807074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.15e-23	8	238	102	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	3.72e-09	48	241	89	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV25740.1|GH17	7.79e-180	1	249	1	249
KGB79281.2|GH17	6.74e-172	1	249	249	497
UOH85421.1|GH17	4.46e-163	1	249	229	477
AAW47222.2|GH17	3.31e-162	1	249	247	495
AUB28743.1|GH17	4.85e-162	1	249	248	496

PDB Hits     

I306_04831-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WUK5|BTGC_ASPFU	5.38e-37	10	248	447	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	5.38e-37	10	248	447	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|A1DEV5|BTGC_NEOFI	4.39e-35	10	248	447	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|A1CAI0|BTGC_ASPCL	2.59e-33	10	248	454	689	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgC PE=3 SV=1
sp|A2QN74|BTGC_ASPNC	3.44e-33	10	248	443	678	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000001

TMHMM  Annotations     

There is no transmembrane helices in I306_04831-t38_1-p1.