CAZyme Information: I306_03549-t38_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: I306_03549-t38_1-p1
• CAZy Family: GH5
• CAZyme Description: cellulase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
895	KN848684|CGC2	96073.13	3.9634

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiEJB2	6908	1296103	145	6763

• Gene Location: location=KN848684:196031-198877(+)

Full Sequence      

MSAFTYTAALFSLISLLPSALAGPTAGTTYSISPNQHPSMCLGPAHDWEGADVVIKDCDE
DDTTWLWTGQSFQNTATQLCIDIRDAGAWSGNKAQVWGCFPYNTNQQFNVEGSMIHWEDF
CWDLTDGSSSAGTKLQIWSCFSYNDNQQWTFTEIEEVDECDATSVTETATIMSTATASNS
DLSSTTASASASNIPEAVSAAESLTASLNASDPFFTASATGSGYEANATASATESAYGSL
NGTASATYSSYDVNATASATYSSYDVNATASATDSGYESINATASATESGYEFVNATASD
TLSASDTLSAETSTATNSSIGEGLWSPHKSSSVSSDEWSSETTTDSSTEWWATSTGSNSW
ASATASASNPWQSASGSGAWNSTSTASNSWETASQSDSWNVTSTASNSWETASQSDSWNV
TSTASNSWETASQSDSWNVTSTASNSWETASSQAWNETSTDSWGGSATATATTSDSYGSA
TSTSTSSAISATATVGTISSGYLQTSGTKIVDSDGNEVILRGTNIGGWLVLEDWMCGISD
ESGSADRFSLTTLENRFGTEQARTLVEAWAENWLTTADFDELANIGFNVIRLPFSFRTVQ
NADGSWRDDAFTRMDWAIAQAKARGIYVIVDFHMWPGQEADYSAISENTDEGQSQRNAVG
EIWKKVATHYLGESSICAFDVINEPTGSYGDYLQQDLYNAVRSVDASRIIIHESISTNPS
TYGWTNVIYSLHEYDMMGSDFDSNKATWANGVQAYIDLWHGYNIPFMLAEFMADGDTLDY
MLNSLNSQGLSWLTWAHSTVNMGRWGIWNHQPFYVDVSSDSYDTIYNTWTNMPSTFHTYI
YDQLKSAATGSTSVSRKRDLAPGARTTKRLHGSHGGRSRRNGVVHAVKGAAAVSI

Enzyme Prediction     

No EC number prediction in I306_03549-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	552	796	3.7e-54	0.9885931558935361

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	5.62e-21	575	796	26	267	Cellulase (glycosyl hydrolase family 5).
395527	Ricin_B_lectin	1.98e-15	35	149	7	126	Ricin-type beta-trefoil lectin domain.
225344	BglC	1.13e-12	572	735	72	243	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
411418	ser_rich_anae_1	1.35e-11	206	478	221	507	serine-rich protein. This serine-rich protein belongs to a family with large size (over 1000 amino acids), which a highly serine-rich central region that averages over 300 aa in length. Species encoding members of this family of proteins tend to be anaerobic bacteria, including Gram-positive bacteria of the human gut microbiome and Chloroflexi from marine sediments.
411418	ser_rich_anae_1	3.80e-10	224	508	231	533	serine-rich protein. This serine-rich protein belongs to a family with large size (over 1000 amino acids), which a highly serine-rich central region that averages over 300 aa in length. Species encoding members of this family of proteins tend to be anaerobic bacteria, including Gram-positive bacteria of the human gut microbiome and Chloroflexi from marine sediments.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV19959.1|CBM13|GH5	0.0	1	895	1	876
KGB75297.3|CBM13|GH5	0.0	1	895	1	909
UOH79756.1|CBM13|GH5	0.0	1	895	1	789
AAW41305.1|CBM13|GH5	0.0	1	895	1	847
AFR92930.1|CBM13|GH5	0.0	1	895	1	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	7.75e-15	512	736	8	256	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1EQP_A	1.33e-14	512	744	3	260	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	1.39e-14	512	744	9	266	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	1.77e-14	512	744	3	260	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
4M80_A	1.83e-14	512	744	8	265	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	2.94e-25	502	800	3	340	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|A1CRV0|EXGA_ASPCL	4.27e-20	519	736	41	272	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|Q4WK60|EXGA_ASPFU	3.37e-18	519	736	41	273	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	4.50e-18	519	736	41	273	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	9.69e-18	520	757	29	275	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999783	CS pos: 22-23. Pr: 0.9820

TMHMM  Annotations     

There is no transmembrane helices in I306_03549-t38_1-p1.