CAZyme Information: I306_03491-t38_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: I306_03491-t38_1-p1
• CAZy Family: GH47
• CAZyme Description: alpha 1,6-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571	KN848684|CGC1	63763.05	5.8082

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiEJB2	6908	1296103	145	6763

• Gene Location: location=KN848684:29239-31227(-)

Full Sequence      

MDPEKGLPPTSTSSSAAPTRLSSPILQHVSFVHNLSPLRQHQHPSTLPHIGLRKRRLLSQ
IIIALGILSIIGWVALGENGMRGVITVVGSKGQGQQRPHDAPVPGIILGTKGKPMPLPDI
EPMELPADVQESSQSSPAPQKGGEDDEEGVSFAEKMAKLSHISSRKWGLDLSPAKLLNGL
APWPSNPPINESAEALSVLGHFADDVYNYGPDTIEEYRKHLRTFIDVGWPKELKEVLTKG
LDRFTMSDAGPVEGEEGYWDWDREKYVWQTDKDLRHVESEEVASWKDWRMDQERWKWDLL
TDDDANKWVKNNLAGTKIEEVWDNLPSGILRADTLRYLLLLLRGGIYSDTDTVLLKSPSH
WGQGARLWNDGEGWLTEDQKKRLEEGAQIEDVLGKPSVIVGLEADVGDREDWHDWWPRPI
QMVQWTMASTPSHPITLSAVLRILHSTATAISWAHENARVINILKDQGRYEDAQNLASVS
VLNEPKHGGPVGVMAWTGPGVWTDAVLSYLRVKYGVKWVDFKGTQEPLRIGDVVILPVTG
FSPGVGNFGSQHRTHREAMVEHRFAGSWKNE

Enzyme Prediction     

No EC number prediction in I306_03491-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	280	362	3.1e-17	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.91e-09	264	570	83	346	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.68e-04	286	368	9	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV19938.1|GT32	0.0	1	571	1	571
KGB75350.2|GT32	0.0	2	571	3	572
AAW41222.1|GT32	0.0	2	571	3	572
AUB22355.1|GT32	0.0	2	571	3	572
AFR92874.2|GT32	0.0	2	571	3	572

PDB Hits     

I306_03491-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	7.70e-47	265	571	144	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	6.46e-38	267	571	100	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q5A4E3|OCH1_CANAL	3.03e-34	325	571	165	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	7.23e-19	317	570	184	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999803	0.000210

TMHMM  Annotations     

Start	End
57	76