CAZyme Information: I306_02982-t38_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: I306_02982-t38_1-p1
• CAZy Family: GH18
• CAZyme Description: NAD(P)H:quinone oxidoreductase, type IV

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
220	KN848661|CGC1	23348.45	6.7605

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiEJB2	6908	1296103	145	6763

• Gene Location: location=KN848661:265852-267185(+)

Full Sequence      

MFSPAWSSFPSDVKKPVIIVAFYSTYGHISALAEEVIKGVESTGAIVKPYFIQETLSAEV
LEKMYAGSSLKPKYPIITPNDLVEADGIIFGAPTRYGRLPAQVSAFFDQTGGLWAKGALV
GKFVSLFTSAAGQHSGHESTAISSFPFFAHQGLVYVPIGYSEPSVGNVDELSGGSPYGSS
TVAASDGHLQPTAKDLRIAAHQGKYFADFVATFVRGKNVA

Enzyme Prediction     

No EC number prediction in I306_02982-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA6	18	210	3.6e-70	0.9794871794871794

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
179647	PRK03767	1.36e-72	18	207	4	192	NAD(P)H:quinone oxidoreductase; Provisional
130816	flav_wrbA	3.36e-64	18	211	3	195	NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR (SP:P03032) are not detected. [Energy metabolism, Electron transport]
223728	WrbA	1.80e-39	14	215	2	207	Multimeric flavodoxin WrbA [Energy production and conversion].
397438	FMN_red	7.30e-07	82	160	67	143	NADPH-dependent FMN reductase.
223503	NorV	8.67e-05	6	125	240	338	Flavorubredoxin [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB79693.2|AA6	4.43e-149	11	220	2	211
AUB22982.1|AA6	1.00e-145	11	220	2	211
AFR93436.2|AA6	1.00e-145	11	220	2	211
UOH81322.1|AA6	1.53e-144	11	220	29	238
KGB79682.2|AA6	1.33e-104	15	220	4	209

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MP4_A	2.24e-55	16	213	2	198	The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_B The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_C The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_D The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_E The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_F The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_G The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C],5MP4_H The structure of Pst2p from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
4LA4_A	2.27e-49	18	217	5	207	Crystal structure of native PnpB [Pseudomonas sp. WBC-3],4LA4_B Crystal structure of native PnpB [Pseudomonas sp. WBC-3],4LAF_A Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_B Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_C Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_D Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3]
3ZHO_A	9.56e-49	18	207	3	189	X-ray structure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],3ZHO_B X-ray structure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],4YQE_A Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],4YQE_B Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],5F12_A WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12],5F12_B WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12]
4DY4_A	9.56e-49	18	207	3	189	High resolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1],4DY4_C High resolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1]
2R96_A	9.85e-49	18	207	4	190	Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R96_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_A Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2RG1_A Crystal structure of E. coli WrbA apoprotein [Escherichia coli],2RG1_B Crystal structure of E. coli WrbA apoprotein [Escherichia coli],3B6I_A WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6I_B WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6J_A WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6J_B WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6K_A WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6K_B WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6M_A WrbA from Escherichia coli, second crystal form [Escherichia coli K-12],3B6M_B WrbA from Escherichia coli, second crystal form [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9AYU0|QR2_TRIVS	1.09e-56	18	207	5	194	Quinone-oxidoreductase QR2 OS=Triphysaria versicolor OX=64093 PE=1 SV=1
sp|Q12335|PST2_YEAST	1.15e-54	16	213	2	198	Protoplast secreted protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PST2 PE=1 SV=1
sp|Q9XBR5|NQOR_ZYMMO	1.60e-52	16	208	2	192	NAD(P)H dehydrogenase (quinone) OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) OX=264203 GN=trpR PE=3 SV=2
sp|A5G4G8|NQOR_GEOUR	4.96e-52	18	215	3	203	NAD(P)H dehydrogenase (quinone) OS=Geotalea uraniireducens (strain Rf4) OX=351605 GN=Gura_2508 PE=3 SV=1
sp|Q74F05|NQOR_GEOSL	2.82e-51	18	211	3	199	NAD(P)H dehydrogenase (quinone) OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=GSU0804 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I306_02982-t38_1-p1.