CAZyme Information: I306_02680-t38_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: I306_02680-t38_1-p1
• CAZy Family: GH16
• CAZyme Description: glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588		65268.82	6.0864

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiEJB2	6908	1296103	145	6763

• Gene Location: location=KN848641:22992-24868(-)

Full Sequence      

MVHTATHPKDAPKNFDFIVLGGGAGGCTVAGRLAENPNVSVLLVEAGVHNPSEISDITTP
AKAMGLRNSEYDWKYKTTMIDRPDYTRIEKPNTRGKVLGGSTALNYYTWVRGSAATFNDW
EEFGGSTWNWENTKNYFNKSTTYHDDLGLFPDDIRSIGNKGGPVDISHSDLVPELKPWRD
ALERAWISKGHEVTVDVYNGVQKGLFKCVNSIYKGVRSTAAAFLEGKPNITLASSTISKK
IIFEGKTAIGVTVIGVDNREYDFYANREVIVAQGVYESAKILMLSGIGIKSDLEALSIQC
IVDSKHVGQNLQDHPILSHVFKIKDGFGLDNHLLRAGAEHDGAIASYRKNHNGPLSSGLL
ELVAFPRIDERLEKHKEYRDYKAQNGGKDPFGPDGQPHFEIDFVPMFADAFQWHFPTPPT
GDYMTIIVDLMRPLSQNGEVKLNSVDPFEQPYINLNFFSHDLDLIALREGVRFIDDILMN
GDGMKDIVEGDYPWPMPRSSDEGMIRQILERSQTGFHPCGTARIGKDIDHGVVGPELTVH
GVKNLRVADASVFPLIPDCRIQNVVYMVGEKAADFIKAAHPDLYKESK

Enzyme Prediction     

No EC number prediction in I306_02680-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	578	1.4e-144	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.62e-94	15	577	6	532	choline dehydrogenase; Validated
225186	BetA	5.92e-93	8	581	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.49e-40	433	572	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.86e-23	15	569	56	569	Protein HOTHEAD
366272	GMC_oxred_N	7.91e-21	94	316	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB80031.1|AA3_2	0.0	1	588	1	588
AUB24176.1|AA3_2	0.0	1	588	1	588
AFR94515.1|AA3_2	0.0	1	588	1	588
UOH84707.1|AA3_2	0.0	1	587	1	570
BCS02092.1|AA3_2	1.39e-293	14	585	8	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.04e-257	13	584	5	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.97e-257	13	584	5	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	8.48e-257	13	584	5	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.17e-63	14	578	1	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.20e-63	14	578	2	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	1.44e-59	13	579	5	536	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q1IG70|BETA_PSEE4	4.16e-56	13	581	3	538	Oxygen-dependent choline dehydrogenase OS=Pseudomonas entomophila (strain L48) OX=384676 GN=betA PE=3 SV=1
sp|B0KN19|BETA_PSEPG	1.53e-55	13	581	3	538	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=betA PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	2.03e-55	13	576	45	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.03e-55	13	576	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000016

TMHMM  Annotations     

There is no transmembrane helices in I306_02680-t38_1-p1.