CAZyme Information: I306_02554-t38_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: I306_02554-t38_1-p1
• CAZy Family: GH154
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	KN848631|CGC2	41365.34	8.3216

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiEJB2	6908	1296103	145	6763

• Gene Location: location=KN848631:532420-533797(-)

Full Sequence      

MSLKVPNRPAEILTPFPRPDPSPEGLKILRQICRKAVESDEVYSVTFSDFLCPEGKNHLF
TLKPYFWEVEPGKWDCDKPGGQKQLETAAITIHNLALGAAYLPEFRNRCIQRLEQILNVF
FIDAETRMVPEVWYAQCNPGSKPLKGDYAFEIALRNIILVDQGMRLAASFLNKRTVHNLA
NWIATQAKWIRDSDQGAAARKYEDNKRIWLEAITASHLSFISPPEGKSYAISFFQTYAPS
HFPKKFFEHELQRTRPRHYTLFALEPLFILAELTLPSSRRLDGHIAQYLRGLLEFAKQVA
PGEIERPLEEQGRYEGRWQWYERMLAGWTGQGERGGGEPDGRAWDGGFTQRMRMIWGFI

Enzyme Prediction     

No EC number prediction in I306_02554-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	94	274	9.2e-26	0.6523297491039427

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	2.37e-12	68	273	41	238	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDT67881.1|PL38	5.86e-17	26	264	44	298
UNE47223.1|PL38	5.57e-12	23	319	83	400
UAL11661.1|PL38	7.13e-12	42	273	86	332
ATC32744.1|PL38	2.28e-11	42	310	84	370
AZS22335.1|PL38	3.02e-11	42	273	81	327

PDB Hits     

I306_02554-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

I306_02554-t38_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I306_02554-t38_1-p1.