CAZyme Information: I306_01787-t38_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: I306_01787-t38_1-p1
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433		45073.28	4.7208

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiEJB2	6908	1296103	145	6763

• Gene Location: location=KN848615:48357-49868(+)

Full Sequence      

MQIGSLVPLLALLAAPAFARSSVHPNAAAHRRQDIAHERVNSAVERREALAQTQPRALAE
KPKFKKINRRGARGCRAKNSTATASDSATASAPSGNSTVVASNSTDTNVTSAVTTQALVG
NTSFSSEIAAATASSIENLAALQQPSSSSSTGDSSTAASSSSVASAAATSSAAATASSSS
NSTGSYTPNGIKAGISGDDPLSFLQGHIGWYYDWNASPSGSASGASAANMLWGAGTVDST
DASRLAAFKALTSTPEYIIGFEEPDCSTPGSSNIAVADAASLWDSTIAPWKAKGSTLISP
SMCHQAAEQYTQWLAGFSGQISTSWDITNLHINKNSMDGVKADIDYYYTTYGKPIWVTEF
ACVDDSTGFVPCTDQSEINTFINDIVDLFESDDRIQAYAYSTGEGLSSQWDMISNGALTE
SGQTYLSAISKYH

Enzyme Prediction     

No EC number prediction in I306_01787-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	205	425	3.2e-56	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	8.62e-62	194	425	4	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
PNP47955.1|GH128	3.34e-81	187	433	7	254
UKZ69748.1|GH128	1.06e-79	187	433	7	254
QYT06237.1|GH128	1.26e-79	187	433	23	270
UKZ58231.1|GH128	1.01e-78	187	433	23	270
UKZ94447.1|GH128	1.90e-77	185	433	5	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UBC_A	2.67e-204	21	433	22	444	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UBD_A	2.52e-82	187	433	29	276	Chain A, Glyco_hydro_cc domain-containing protein [Trichoderma gamsii]
6UAQ_A	1.70e-09	190	428	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	4.12e-09	190	428	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAS_A	9.98e-09	190	428	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	6.71e-12	202	427	312	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000651	0.999336	CS pos: 19-20. Pr: 0.9763

TMHMM  Annotations     

There is no transmembrane helices in I306_01787-t38_1-p1.