CAZyme Information: I306_01040-t38_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: I306_01040-t38_1-p1
• CAZy Family: CE17
• CAZyme Description: GPI mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		47485.95	8.9019

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiEJB2	6908	1296103	145	6763

• Gene Location: location=KN848586:131729-133175(+)

Full Sequence      

MVKLSPLALIFIAACFSRILHLTVLSGLSKALPLFDTSPSLLLPSPPPSLRWDAIHFSSI
AYNGYEYEQQVAFQPGWLAVMRLAGEGVRFIRAASVVELKDVILGSTIMANFAFVAATLV
LYKLTKHIFNPTFALLTSLLYLLPPTATPSAPYTEPIYSLLTFSGIYLLSIKRQMVLAGL
CFAGATTVRSTGIFNLITLTCFAVFGDAHMLDISDKDYAKRMTRKTWKPYLPALLVVAPF
IMFQYYCETVFCTRELKLANTARPWCSNSPPVSYGFVQKLYWNVGPFEYWTLAQLPNIAL
AMPILSFSLVGFVQYFSHLVSSSQVLNHGTDEKPPPPILFELYSVHLLTMALLLFTSHTQ
IALRVCLGDPVVWWNAVKLGFDNVEIDECRKGHVKMNKFGRYWVGWTVVWGAIAAVLWAG
HYPPA

Enzyme Prediction     

No EC number prediction in I306_01040-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	48	425	2e-98	0.8722358722358723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	4.22e-31	52	425	60	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	2.00e-10	51	425	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV21212.1|GT76	5.92e-316	1	425	1	425
KGB77682.1|GT76	2.63e-282	1	425	1	423
EAL22094.1|GT76	2.99e-272	1	425	1	423
AAW42711.1|GT76	2.99e-272	1	425	1	423
UOH80020.1|GT76	3.11e-271	1	425	1	420

PDB Hits     

I306_01040-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP63|GPI18_CRYNB	5.31e-273	1	425	1	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1
sp|P0CP62|GPI18_CRYNJ	5.31e-273	1	425	1	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	5.44e-32	35	425	29	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q5KR61|PIGV_RAT	9.33e-28	51	389	65	430	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q4WQ21|GPI18_ASPFU	1.94e-27	22	425	33	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.605489	0.394508

TMHMM  Annotations     

Start	End
7	29
102	121
128	147
152	171
192	211
231	253
295	317
337	356
399	421