CAZyme Information: I306_00541-t38_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: I306_00541-t38_1-p1
• CAZy Family: AA6
• CAZyme Description: myo-inositol 2-dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	KN848571|CGC1	39769.04	6.1857

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiEJB2	6908	1296103	145	6763

• Gene Location: location=KN848571:2123-3485(+)

Full Sequence      

MSAALSNKLKYAVFGVGRMGQRHALNVAFRTPRAELVAVADPKPSTPQWMKDNLPPSTKY
FESYEDCLANSGADAVLIASATSWHAPMAIDAMHAGKHVLLEKPISIDLETSRSVVNEAE
KFPDLKVMVGFSRRFDESYREARKMVENGTLGKAHLIKSATNDQYDPSGFFVSYAAASGG
IYIDCGIHDIDCARWLLDASLGIPNPKKQVRRVFAAGHNIRHPELVQDNDVDNAVGFVEF
ENGKMLVLHLSRTAMHGHDCFAEIFGTDGKVIINGNPQLNRVEIRDAHGVRTESTPTYYE
RFKDAFVTEVNEFTSAVLDNKPVPVSVIDALEASKIATALTHSFKTNTPVFFDEEGEPIL
A

Enzyme Prediction     

No EC number prediction in I306_00541-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	7	155	1.3e-23	0.38596491228070173

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
275173	myo_inos_iolG	4.25e-105	8	350	1	329	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]
223745	MviM	1.74e-70	6	350	1	338	Predicted dehydrogenase [General function prediction only].
396129	GFO_IDH_MocA	3.82e-22	9	131	1	120	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
397161	GFO_IDH_MocA_C	8.97e-20	143	350	1	202	Oxidoreductase family, C-terminal alpha/beta domain. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
183212	PRK11579	2.80e-10	5	193	1	185	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPG91011.1|GH0	8.54e-96	7	351	2	336
URL57904.1|GH0	2.22e-93	9	350	4	335
URX63132.1|GH0	1.26e-92	9	353	4	338
QHT70649.1|GH0	3.64e-15	3	322	41	371
UPK44969.1|GH0	6.00e-15	8	276	3	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4N54_A	1.63e-61	6	347	12	345	Chain A, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_B Chain B, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_C Chain C, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_D Chain D, Inositol dehydrogenase [Lacticaseibacillus casei BL23]
4MKX_A	4.94e-61	9	347	18	348	Chain A, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4MKZ_A Chain A, Inositol dehydrogenase [Lacticaseibacillus casei BL23]
3CEA_A	4.92e-50	9	343	9	335	Chain A, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_B Chain B, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_C Chain C, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_D Chain D, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1]
3EZY_A	1.95e-48	9	354	3	333	Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_B Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_C Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_D Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima]
3EUW_A	4.77e-34	9	357	5	337	Crystal Structure of a Myo-inositol dehydrogenase from Corynebacterium glutamicum ATCC 13032 [Corynebacterium glutamicum ATCC 13032],3EUW_B Crystal Structure of a Myo-inositol dehydrogenase from Corynebacterium glutamicum ATCC 13032 [Corynebacterium glutamicum ATCC 13032],3EUW_C Crystal Structure of a Myo-inositol dehydrogenase from Corynebacterium glutamicum ATCC 13032 [Corynebacterium glutamicum ATCC 13032],3EUW_D Crystal Structure of a Myo-inositol dehydrogenase from Corynebacterium glutamicum ATCC 13032 [Corynebacterium glutamicum ATCC 13032]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40332|IOLX_BACSU	1.39e-59	5	353	1	334	scyllo-inositol 2-dehydrogenase (NAD(+)) OS=Bacillus subtilis (strain 168) OX=224308 GN=iolX PE=1 SV=2
sp|O05389|YRBE_BACSU	8.99e-53	5	350	1	331	Uncharacterized oxidoreductase YrbE OS=Bacillus subtilis (strain 168) OX=224308 GN=yrbE PE=3 SV=2
sp|Q9WYP5|IOLG_THEMA	1.54e-47	9	354	1	331	Myo-inositol 2-dehydrogenase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=iolG PE=1 SV=1
sp|O68965|MI2D_RHIME	9.70e-32	9	343	3	320	Inositol 2-dehydrogenase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=idhA PE=1 SV=2
sp|P09400|STRI_STRGR	6.56e-28	9	353	1	332	Streptomycin biosynthesis protein StrI OS=Streptomyces griseus OX=1911 GN=strI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I306_00541-t38_1-p1.