CAZyme Information: I306_00318-t38_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: I306_00318-t38_1-p1
• CAZy Family: AA14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455		48999.65	4.4473

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiEJB2	6908	1296103	145	6763

• Gene Location: location=KN848559:78210-80080(-)

Full Sequence      

MGDNLATEMEEHYKTFVTEEDFALIAGAGLNYVRIALGYWAVETIDGEPYLAKVSWNYFL
KAIDWARKYGLRLLIDFHALPGSQNGWNHSGKTGSVNWLYGVMGVANAQRSLETLRSIVE
YISQDGIKQIVPMIGLVNEVQGKTVGQDVLTAFYYQAYELIRGISGYGAGNGPIILLHEG
FYGIAAWNGFLAGADRIGLDQHPYLAFPVTQIPDNHTVQAHTVCGWGGGTNDTSTSYGII
IGGEWSNAINDCAYWLNGVDSTPQFELTGTGNCTGVEEWFNYSDETKQSIMDYTLANMDG
YPTSPMWHYKLGLEQGWMPKDPRVAGGHCQNIGVGGNQFAGTYPASAVGSFPTDVATPTI
DPTQVASHSVWPPTALGPTPSYSAAQITLFPTLTQTGTRNVLATPTHPSNVTLGGGWANA
ADATGAWVRVAGCDYPDEYDANTAAVPTAQCTGSL

Enzyme Prediction     

No EC number prediction in I306_00318-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	11	308	9.9e-91	0.9735973597359736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.28e-28	2	299	58	349	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV23065.1|GH5_9	0.0	1	455	245	699
KGB75903.2|GH5_9	0.0	1	455	316	788
AAW44208.2|GH5_9	6.46e-317	1	454	313	784
AUB26004.1|GH5_9	6.81e-314	1	454	313	784
AFR96122.1|GH5_9	6.81e-314	1	454	313	784

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	8.36e-47	9	307	61	354	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	8.36e-47	9	307	61	354	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	9.55e-47	9	307	67	360	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PBO_A	9.55e-47	9	307	67	360	Chain A, Hypothetical protein XOG1 [Candida albicans]
3O6A_A	1.81e-46	9	307	66	359	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CHZ8|EXGD_ASPTN	1.87e-64	1	320	466	815	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgD PE=3 SV=1
sp|Q4WMP0|EXGD_ASPFU	3.38e-64	1	309	461	786	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgD PE=3 SV=1
sp|B0Y7W2|EXGD_ASPFC	3.38e-64	1	309	461	786	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgD PE=3 SV=1
sp|A1DMX4|EXGD_NEOFI	3.42e-64	1	309	462	787	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgD PE=3 SV=1
sp|A1CTI3|EXGD_ASPCL	1.58e-62	1	309	459	783	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I306_00318-t38_1-p1.