CAZyme Information: I306_00062-t38_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: I306_00062-t38_1-p1
• CAZy Family: AA1
• CAZyme Description: rhamnogalacturonan lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605		67523.70	4.2862

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiEJB2	6908	1296103	145	6763

• Gene Location: location=KN848549:181344-184450(+)

Full Sequence      

MTTLGAMTGLEFDHVDVLGPVSGRIDYVGQSQKASFEVHQGNDSNNNPWIGLTMSETYEG
TGQFFQQWWFLRDGEPGYHTFTRLQFDNGTEGIDLGNLQEFRQVISPNSNIWTHLVTNDV
QYGHLPSDEAIGNQTTVQDATWYYNITEGNSYKTESSDYFTKYEWADLYGDHFAHGFYAD
GTASNGSTLGFWTVFNNLEGYTGGPLRSDLVVDTNIYNYYASNHRGASTMNITSGFDRIF
GPTFIYLNKDGDLHSLYDDAKSYANTSFAADFYDGVADLIPGYVNSSGRGDFKAQISLPK
GASKPKIILAQSGVDPQDNVDYAAKQYWASVSSDGSVTIPRVQAGTYRVTLYAEGVFGQF
EQDGVVVHAGDGDGDKFQINWEAERHGIELWRLGVPDKTAGEFLHGFAKDPQHTLHQEEY
RQYWGAWDFPTDFPEDVNFTIGVSDPSKDWNYVHYSRYGGSFTRPEYVLDNVNVWTVNWM
PEGGLDVSGKTAALTVQLAGARTASGNLDLPEPTSNYSNVDYTVNVNGNPLTWTILYNQS
SSCSDRSGIACYNLRNVFTFPGEWLKNDTNVFEFVLPYNASGGDVNFRNYSISVLYDAIR
LELSD

Enzyme Prediction     

No EC number prediction in I306_00062-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	26	584	2.5e-288	0.8908227848101266

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199907	RGL4_N	2.49e-47	22	256	63	265	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199905	RGL4_C	7.69e-28	391	602	1	161	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199904	RGL4_M	2.55e-24	288	370	1	84	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405384	CBM-like	4.35e-22	390	601	2	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.
405387	fn3_3	3.31e-20	299	370	1	70	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV22792.1|PL4_3	0.0	1	605	1	605
KGB76130.3|PL4_3	0.0	3	605	44	676
UOH82151.1|PL4_3	0.0	3	605	44	677
AFR95878.2|PL4_3	0.0	3	605	44	677
AUB25736.1|PL4_3	0.0	3	605	44	677

PDB Hits     

I306_00062-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8N5T6|RGLB_ASPFN	2.61e-182	5	604	46	663	Probable rhamnogalacturonate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rglB PE=3 SV=1
sp|Q0C7K7|RGLB_ASPTN	3.82e-181	5	604	45	660	Probable rhamnogalacturonate lyase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=rglB PE=3 SV=1
sp|A5ABH4|RGLB_ASPNC	6.99e-174	5	581	46	640	Probable rhamnogalacturonate lyase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rglB PE=3 SV=1
sp|Q5AZ85|RGLB_EMENI	1.68e-171	5	603	45	659	Rhamnogalacturonate lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rglB PE=2 SV=2
sp|B0XPA2|RGLB_ASPFC	1.62e-168	5	603	46	657	Probable rhamnogalacturonate lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=rglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999675	0.000353

TMHMM  Annotations     

There is no transmembrane helices in I306_00062-t38_1-p1.