CAZyme Information: I303_08457-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_08457-t42_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		46984.96	5.4207

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894038:85612-86844(-)

Full Sequence      

MSTPRTWIEASGHRVTRLSDEAGSSSLYFNFNAYTPEGDFLVISTPTGIAKIELSSFKLS
PVITIDEHFSLLFVGKTYRRAYYRLNDAKTLHWVDLDTGVTHVIAKEPLGDIQTINSDET
YLAGVEVDPTYKSDILELFSKRDPKTDQFVYEANWPDGTPMTYADAKEVRLSQRLNARAP
MVLFLIDVNTGERKDVYKATDWLNHLLFSPTDATILMFCHEGPWHQVDRLWLLDLKGDLK
PQRIHERRMNMEIAGHEWFSHDGKTVWYDLQTPRGEDFWIAGYEIETGKRTHYHLERNEW
SVHFHSSYDNSLFCGDGGDPEMVAHAEDGMYLYLFQPKRIPDVAGLKSPDAGKLIVPGFF
ESKKLVDLKDNDYRLEPNANFTPDGKYLVFRNAKYGGLHVYAVALEPEIA

Enzyme Prediction     

No EC number prediction in I303_08457-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL22	180	403	7.6e-80	0.9898477157360406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
291262	Pectate_lyase22	1.55e-13	80	408	93	384	Oligogalacturonate lyase. This is a family of oligogalacturonate lyases, referred to more generally as pectate lyase family 22. These proteins fold into 7-bladed beta-propellers.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIJ47411.1|PL22_2	1.73e-191	4	405	32	441
AOH85032.1|PL22_2	6.69e-187	2	408	24	437
QXT35974.1|PL22_2	1.91e-186	4	403	25	431
AYV48348.1|PL22_2	7.08e-177	4	405	31	434
ADL02180.1|PL22_2	1.30e-158	4	405	41	448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PE7_A	2.39e-18	183	409	170	386	Oligogalacturonate lyase in complex with manganese [Yersinia enterocolitica subsp. enterocolitica 8081]
3C5M_A	9.53e-16	77	408	90	384	Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633],3C5M_B Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633],3C5M_C Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59418|OGL_PECAS	5.07e-13	183	409	170	386	Oligogalacturonide lyase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=ogl PE=4 SV=2
sp|P21258|OGL_DICD3	2.17e-12	183	409	170	386	Oligogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=ogl PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I303_08457-t42_1-p1.