CAZyme Information: I303_08301-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_08301-t42_1-p1
• CAZy Family: PL14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520		58837.66	4.5878

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894037:555510-557716(+)

Full Sequence      

MSLSTWIDTLRSQRYSLLPTNSVPTSPEPIKHTSTKKRLFQTTLVALVLMGIIGYSLKSV
KTVTIEEEPIEFQESQPIIGDTDTAKPLDPPDFDVGSEIPPDSVEIPSTSTSTDSEADVD
VEVDTEAWRAAGNWGVSEDLGWISPPYNSSVLGEVAEGRYRLGFSAGETGSREYFQRLHD
FALSLPEPLHTPLLSSLFYHSPPNYENIVSTFYPDQPHSPSMISYKYIHQTDKEYNPENE
LPKVWESINKPDGWRMNFLDDAQAHNWMLSQFEGSDVNWAWDYMHRGVLKADFLRYLLPL
VVGGVYSDVDTRPIRPIEEWGTHSVELLDLSYTDGAEWRSRISTHPAVIVGVDVDVHNKE
GWQNEWPRPLGICQWTLSSAPSHPIFLDAVRRVVNSTRVVEAWEEWRIDEIQKLESDGQV
EQAEELKGQHRDHAMNVMEWTGPGLFTDSVVAFLLARYNVSWHRLRSLDHPLRIGDVLIL
PITGFSPGGERDFGAENPDSIQANVLHNFRGSWKGDGARK

Enzyme Prediction     

No EC number prediction in I303_08301-t42_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.31e-12	185	448	48	281	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	9.86e-07	271	324	34	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW43978.2|GT32	1.15e-187	1	518	1	500
AUB26041.1|GT32	4.63e-187	1	518	1	500
AFR96155.2|GT32	4.63e-187	1	518	1	500
ADV23039.1|GT32	1.41e-183	1	518	1	500
KGB75873.1|GT32	2.39e-182	1	518	1	491

PDB Hits     

I303_08301-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	3.11e-44	240	516	141	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.43e-32	226	517	101	379	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	6.57e-27	243	516	122	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	2.07e-21	227	514	133	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000025

TMHMM  Annotations     

There is no transmembrane helices in I303_08301-t42_1-p1.