CAZyme Information: I303_08106-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_08106-t42_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		43687.63	6.7172

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894036:1597914-1599118(-)

Full Sequence      

MCSWNHHTALAEVTATDRLGAYVMWTSTVRPAGFLNSEAVLMSKLWMNKVWSWDNCINGL
ALVRYDVNLALDQILLPFHRITPEGRLPDSVARNEVLFDYTKPPVYGWTLFKLLGLLDGQ
SSESHPVFTTLGTARLTEIYEKVSLFTDFWYKHRKTTASVLPYYSHGNDSGWDNSTAYDQ
QTVCVSPDLAAFLIVQCDFLGKLAVHLRHDWVKWTSLRHQTLQGLLQELWNDEEGKFMFK
DALSGRTWLSTSLLQFLPLIAARHLPQTIVDRLANNLTPYLSEWGLATERLDSKLYEPDG
YWRGPIWAPSTLMLESGLRSAGYQDLADDISDRYLRLCAHNGFAENYNAKTGKGNRDLSY
TWAASAYLVLRSEQETRKKTGPM

Enzyme Prediction     

No EC number prediction in I303_08106-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	26	372	2e-36	0.4087719298245614

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225942	GDB1	4.04e-11	46	368	281	600	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	3.16e-04	286	371	691	781	alpha-glucosidase; Provisional
395961	Trehalase	0.002	213	338	333	459	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIY99965.1|GH63	6.81e-117	14	378	222	576
UDF14426.1|GH63	5.42e-116	21	380	224	571
QUW83638.1|GH63	9.66e-114	14	378	222	576
QIY69504.1|GH63	9.66e-114	14	378	222	576
QIZ97665.1|GH63	5.30e-113	9	377	209	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WVA_A	7.22e-12	226	368	273	416	Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
2Z07_A	4.07e-11	226	368	273	416	Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus],2Z07_B Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D8QTR2|MGH1_SELML	1.28e-07	229	369	342	483	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
sp|D8T3S4|MGH2_SELML	1.28e-07	229	369	342	483	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999919	0.000117

TMHMM  Annotations     

There is no transmembrane helices in I303_08106-t42_1-p1.