CAZyme Information: I303_08085-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_08085-t42_1-p1
• CAZy Family: GT69
• CAZyme Description: endoglucanase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	KI894036|CGC5	54989.23	5.9528

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894036:1539904-1542285(-)

Full Sequence      

MSALSQNEYLVVKGEDITLHGKPILLKGAGLGGWMNMENFITGYPGHEFQARAAIKKVLG
QEKYEFFFDKFLEHFFGEEDAKFFASLGLNCIRLPVNYRHFEDDMNPRVFKKEGLKHLDR
VINLCAKYGIYTVIDLHAAPGGQNIDWHADAGNHQALFWEHKDFQDRTILIWENLARHYK
DNTWVAGYNPLNEPTDIEHTRLLDFYVRAEKAIRDIDPHHILFLDGNTFGADFSRFGEPL
PNAVYACHDYSVYGFPNPPADFTGSAEQVAYHERSFNRKVEYMKKIGGPIWNGEFGPVYQ
NANDGLPDWQEINERRYNVLECQLEIYAKSKTSWSIWLYKDIGFQGMVYVGEDTPYMLRL
KPFLEKKKRLAADEWGCDDIPVREVFDPLEKWFLDAVPSLSQRYPKTWKPATHIGRLVRN
ILLSEELCHEFGQYFEGLGFDELEALAKSFSFESCKQRTKLNDILTDDSKRGASK

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	52	342	1e-127	0.9965034965034965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.35e-22	78	341	27	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	1.06e-18	75	340	73	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
225343	BglB	3.69e-06	74	137	59	121	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW44253.2|GH5_22	1.12e-258	2	472	6	480
AFR96086.2|GH5_22	1.84e-257	9	472	17	480
AUB25961.1|GH5_22	1.84e-257	9	472	17	480
ADV22976.1|GH5_22	2.58e-239	9	472	17	454
UOH81960.1|GH5_22	9.63e-218	9	472	10	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	2.45e-23	63	288	16	231	Chain A, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	6.15e-23	63	288	16	231	Chain A, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3O6A_A	1.97e-12	14	351	2	381	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
3W0K_A	7.45e-12	83	340	30	294	Crystal Structure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus],3W0K_B Crystal Structure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus]
1EQP_A	8.10e-12	25	351	8	376	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	3.38e-206	9	468	3	468	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|P23340|GUNC_CLOSF	5.00e-23	63	288	16	231	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
sp|A3DJ77|GUNC_ACET2	5.00e-23	63	288	16	231	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
sp|P0C2S3|GUNC_ACETH	2.33e-22	63	288	16	231	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
sp|P16169|GUNA_RUMFL	2.86e-22	25	314	7	279	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I303_08085-t42_1-p1.