CAZyme Information: I303_08045-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_08045-t42_1-p1
• CAZy Family: GT66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		68749.02	5.9359

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894036:1416422-1419090(+)

Full Sequence      

MSSSSASSSSTSRRSSSDHSASAFSNSSTVFSPTISNSQTFKSNHSRNSSRTSGFGGFAK
AFIHDNKHEDLEENEKNLDDDPLLPQYQLPRSPSLDQVSSFTHLPTKLPLSLPHPHIGLR
RRRLLSQVLGVLGILTFVGWWMGENGYMRNVFNDGGGISSEYVQDPKLPGVIIGFNGHDL
LEETKAELSHAEKMASLAQIRPQEWGLGLSTEHFLAGLRQFPENPPITTALSVLGTFADN
IYLLGPLEKRDYFYQMREFANEVFPKGIAEGLVGGLIGYIGHPDQPDFDAAYAYAEQPGG
AGGGRQSWDSTKHIWQTDKDTKKKGSQEVGSWKDGKAFDEGWEWDLLTDSDADKYVNRRL
AGSRFKEIWDNLPSGILRSDTLRYLLVLLEGGIYTDTDTTLLKSPSEWGNNPKLFKGGQG
WLTEDQLERISNGENIDDIIGRPSVIVGLEADVGDREDWFDWWPRPLQIVQWTITSAPNH
PIALNALLRIYHSTVKAIEWSHSVAHSVNVLKDQGRYEDAKKLAEVGVLNEPKNGGPVGV
MAWTGPGVWTDAVLSYLRVKYGLVWTDLKNLRVPMRIGDVVVLPVTGFSPGVGNFGAQMN
THPQAMVEHKFAGSWKEKEN

Enzyme Prediction     

No EC number prediction in I303_08045-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	331	411	8e-16	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.64e-16	312	618	84	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.08e-09	363	409	41	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB22355.1|GT32	1.57e-206	92	616	25	570
AFR92874.2|GT32	1.57e-206	92	616	25	570
AAW41222.1|GT32	2.07e-204	92	616	25	570
KGB75350.2|GT32	2.93e-204	115	616	49	570
UOH79704.1|GT32	4.16e-204	92	616	25	570

PDB Hits     

I303_08045-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	9.67e-43	309	617	141	395	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	9.94e-35	312	617	101	377	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.88e-34	372	617	163	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	5.16e-16	367	589	187	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

Start	End
124	143