CAZyme Information: I303_08010-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_08010-t42_1-p1
• CAZy Family: GT58
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
659		72618.29	4.3727

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894036:1297701-1299752(-)

Full Sequence      

MSSSIAYATTFFTLLSLLPSVLSAPSDGTTYQIESNHFSNKCMGVQGDWNGAKVVLKDCD
DDDTTWKWTGSHLENTATNKCIDIPDGGWWNGNKPQIWDCFSYNTNQQYSVVNSNIKWGN
WFCLDITDGNSNSGTTIQLWQCFDGNTNQQWTFTEVEEVEDPSDDDDCESATVTATATAT
STIGGGLWVGSPTSTASSSSSSSSAAVNETASTTADWWATSAVTASATASVTASKNSTQT
ASATSSASTSVTTGSVSSGYLQTSGSKIVDSDGNEVVLRGTNIGGWLVWEDWMCGITDSM
NPDRFPLNTLESRFGADQANTLWEAWINNWLTEDDFDNISNIGFNVIRLPFGFRNLYDSN
GNWRSDAFTHLDWAVAQAKKRGIYVILDFHIWAGQQASYSAISENTSDGQSQRDAAGEIW
KKVATHYLGEPIIAAFDIINEPTGSWGNNLQQDLYNAVRSVDANRIIIHESISTDPRQYG
WTNVVYSFHEYLMMGSDYSSNVQQYAQSVQAYIDQWTGYGIPSMLGEFMADGETLSYILN
QANKYNLSWLSWAHSTVNMGRWGLWNHQGFYVDVSSDSYDSILNQWSNMPSKQQSTIIYD
QFKAGATGSTSVSQRKRDEITPVLTRSERVEGTKRLTARHGGRSRRSVAGQHGIQGISF

Enzyme Prediction     

EC	3.2.1.39:5	3.2.1.14:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	309	553	1.6e-55	0.9885931558935361

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.72e-23	326	553	19	267	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.24e-16	314	491	57	242	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	5.17e-15	36	151	7	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	6.23e-14	31	153	1	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	7.61e-11	72	155	4	86	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UOH79756.1|CBM13|GH5	7.94e-225	7	658	6	785
AFR92930.1|CBM13|GH5	1.59e-224	7	658	6	785
AUB22412.1|CBM13|GH5	1.59e-224	7	658	6	785
AAW41305.1|CBM13|GH5	1.27e-216	3	658	2	843
ADV19959.1|CBM13|GH5	1.15e-213	3	658	2	872

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	6.26e-14	270	505	3	264	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	8.60e-14	270	505	8	269	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PF0_A	1.53e-13	270	505	9	270	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	1.97e-13	270	505	3	264	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
4M80_A	2.03e-13	270	505	8	269	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	1.61e-25	260	495	3	252	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|Q96V64|EXG_BLUGR	1.70e-16	272	520	31	306	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	3.73e-15	277	528	41	308	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|Q4WK60|EXGA_ASPFU	8.88e-15	277	528	41	309	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	8.88e-15	277	528	41	309	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000191	0.999812	CS pos: 23-24. Pr: 0.9836

TMHMM  Annotations     

There is no transmembrane helices in I303_08010-t42_1-p1.