CAZyme Information: I303_07359-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_07359-t42_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
725	KI894035|CGC8	77490.83	3.9083

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894035:1089580-1091982(-)

Full Sequence      

MTPITMKHAIYLTLSIILATDSVVAAGPHNRFGVSHHRRHHARAAAAGTSLPHQETRSTP
EIIEQRQQEECTLGAWKCVGSELQRCYNDQWNFVTNCTGTDIVCSDGLYTTGCVWTWSVE
QNEDSNQSATSSPPFTASITATATSSATSTTIASITNANLAVQPTAATDDEDQECDEDDD
EEEEQDAEDDDDDLPYCEDDEGSDSMSITPTASTVTSAAVASPSVVGGELAANPNIAQDD
DDEEECDSSEDDTEDDTSASPTTTSSATTASTSVIGGQLWAGDDNSWENTASATTHDWYN
TNDPYSTGTATTTSPHWYNTNDPYPTETASSSLSSVDWWSNGNDNANGNHHGHKSSSASS
ADWSATTSSSPSWDDGSWSPTKYDSASGATTTDWNNWSGESTSSAAWGQESASSSGKHGK
GSASASASASASTGTGGKTTGSPSGSFSSAPHYVIYSDMWLTEMPSVDVLSNFNRLILAF
WMTNQGAVDNAQFWEQLDSNTRQKTLTEYHNAGIALMVSAFGSTDSPTSNGADPTQTAQQ
LAQWVKDYGLDGVDIDYEDMPAMNSAQAVSWIVTFQKELRRQLPAPYIISHAPVAPWFTS
AKDYSDGAYVSIHRQTGDGIDFYNIQFYNQGDGVYEDCKTLLFNSGNDWPSTSVFEINSS
AGLPLDKIVIGKPLDEGAAANGFVDPSVLNKCVSQAQAKGWNAGVMFWEWTTSAPSIMGT
VRGTN

Enzyme Prediction     

No EC number prediction in I303_07359-t42_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119349	GH18_chitinase-like	7.89e-28	453	629	1	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119350	GH18_chitinase_D-like	1.01e-14	545	708	106	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
119363	GH18_CTS3_chitinase	1.05e-14	539	710	102	253	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
226000	Chi1	2.13e-13	468	708	55	302	Chitinase [Carbohydrate transport and metabolism].
119361	GH18_narbonin	5.82e-09	545	664	109	220	Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L.) cotyledons with unknown function. Narbonin has a glycosyl hydrolase family 18 (GH18) domain without the conserved catalytic residues and with no known enzymatic activity. Narbonin amounts to up to 3% of the total seed globulins of mature seeds and was thought to be a storage protein but was found to degrade too slowly during germination. This family also includes the VfNOD32 nodulin from Vicia faba.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW43533.1|GH18	1.49e-146	11	723	2	582
KGB77976.2|GH18	3.62e-145	11	723	2	627
ADV22450.1|GH18	2.18e-137	11	723	2	550
AFR95478.1|GH18	9.67e-137	11	723	2	634
AUB25287.1|GH18	9.67e-137	11	723	2	634

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K7Z_A	1.01e-18	513	712	69	264	Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_B Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_C Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia],6K7Z_D Crystal structure of a GH18 chitinase from Pseudoalteromonas aurantia [Pseudoalteromonas aurantia]
4RL3_A	8.95e-10	455	645	11	202	Crystal Structure of the Catalytic Domain of a family GH18 Chitinase from fern, Peteris ryukyuensis [Pteris ryukyuensis],4RL3_B Crystal Structure of the Catalytic Domain of a family GH18 Chitinase from fern, Peteris ryukyuensis [Pteris ryukyuensis]
6EPB_A	8.64e-08	494	722	98	333	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
3EBV_A	1.62e-07	512	696	74	250	Crystal structure of putative Chitinase A from Streptomyces coelicolor. [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q838S2|CHI18_ENTFA	3.43e-07	494	709	98	321	Chitinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0361 PE=1 SV=1
sp|P48827|CHI42_TRIHA	2.37e-06	494	722	98	333	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000342	0.999627	CS pos: 25-26. Pr: 0.9677

TMHMM  Annotations     

There is no transmembrane helices in I303_07359-t42_1-p1.