CAZyme Information: I303_06877-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_06877-t42_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
927		101824.95	6.1528

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894034:1444930-1448850(-)

Full Sequence      

MVTKDDSNKPYYLQQDSEEEQGIVLPAEEDDPTIPPDESKKDRKDRVEKEKKAGVKRVKV
GKVEVDPSVDYANFTSGGPGLDSKAVLDDMGMINIWVNLKKPLPDLPKDYARPVKEYAVD
RREGVKCPPLNIVIFIVGSRGDVQPYMSLALHLITTHSHRVRIATHPDFKEFSLEGKLEY
FDVGGNPKELMAYMVKSESSIYPGLLPGMASLTNGDISSKRKMTSEMLEGFHQSTYTPDP
VTGRPFAADAIISNPPAFGHVHIAEALGLPLHMSFTMPWSPTTAFNHPLVNVEQSNAEKG
LTNYLSFALAEMLTWQGLGDVINSFRSKTLFLEPLSMGSGPSIVDRLKIPWTYCWSQGLI
EKPKDWKEHIDISGFYFMEGDQTFQPEQELKEFLKAGDPPIYIGFGSVVVEDAAAMTKTI
FDAVKSAKVRALVSAGWGGLGGAEVPDNVFILEGNIPHDWLFSEGRVSAVCHHGGAGTTA
IGLRNGLPTIVVPFFGDQAFWGNMIHKAGAGPAPIPQKTLNVENLAKALEFAISPHAKSA
AGEMAQKIKSENGEIKGVESFHRHLPLLNMRCDVDPSRLALWYSDKLHLRLSGPVAALMV
EKGMIDWKDLEVHRAKEYDSKRRVVDPISGGATAILGTVTGYYSGIAQIFYNPPKGIINT
TTAIPRGLINIVDNIYEGMDNIPRMIGSEEVREKGKVDDFESGVKEGAKGVFYGYWDGIT
GLVREPVEGAKKEGFVGAIKGMGRSYVNATVRPAIGIMGAISLPLRGATKAFKNKFSAPQ
EIVLQQPRKLLSVESLATLSEEKKTELSKKFEDMTTPAKVKERNEQLKKRAKRLLAGDAS
ALEEDSSQTQSQGEKGEDLVEKDMEKISIQAPTQVSAQDESASRTGEANAKADTSRTGES
QLSKEEQEAEQRGYERALKELKEREGR

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	235	563	8.7e-49	0.774869109947644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.28e-73	130	564	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	4.09e-36	132	553	4	387	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	3.27e-16	132	285	1	138	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
227376	MRS6	9.91e-06	635	774	2251	2418	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].
179385	PRK02224	1.62e-05	794	924	482	614	DNA double-strand break repair Rad50 ATPase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW15356.1|GT1	1.78e-300	57	781	36	758
QRV86802.1|GT1	1.22e-295	57	781	36	758
QRW00852.1|GT1	1.39e-294	57	781	36	758
QRW26844.1|GT1	1.49e-294	57	840	36	817
CCA73033.1|GT1	2.26e-244	70	785	39	746

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.65e-69	134	565	24	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	2.73e-69	134	565	44	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	9.40e-28	130	551	1	368	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	1.40e-23	130	555	1	389	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1PN3_A	4.59e-19	130	541	1	364	Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PN3_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PNV_A Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis],1PNV_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	9.19e-121	128	566	191	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	1.08e-118	128	566	154	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	5.75e-70	134	565	999	1413	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q9Y751|ATG26_KOMPG	7.03e-66	131	565	762	1178	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1
sp|A7A179|ATG26_YEAS7	5.29e-65	134	565	744	1159	Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I303_06877-t42_1-p1.