CAZyme Information: I303_06501-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_06501-t42_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
567	KI894034|CGC9	58395.54	10.6446

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894034:390714-392773(+)

Full Sequence      

MKLSILLAVLPLLAIGSVAPAPAPASASASASHSVSLSVSKGSSSASSSIKSSTTSFSSS
KSITTSKVSFSTPSSKTSTSPASKTSSGTIKATSTSSTSSKSDSKTQSTPTTTSKSSLAT
SAISKSSSSTPSTSKLSTSISKASSSIAKSSSSVAPSSTSLIKKATTTSSSTSIAKTSSA
PASSTSKVNTSGSSSKPLSSSMSKASSSTSKTSTSTAKTSSSSSRSAWSSAKTSSSTSKA
PSSTSKATSSAIKTSTSTSKASSSSSKPSSSVVKTSTSTSTSKASSSSSSKTSTISSAMK
STTTSKISTSTTTTNTTAKMTSTSAAIQTGNAGSSSGLGLSWQSYQKLANTKGLGWYYNW
SFWPMTMGNVEYVPMIWGEGSINDWDGTVPSGSTHILGFNEPDQGNSAGGSSMNVTQGAV
LHQKWTSKLKDKSIKIGTPAVARGGTWWFNGWLQACNGQCKFDFVPIHFYGTNANDMITY
IKTFPAQGKPIWLTEVACLDFSSGQKCTFQQNKDFMKTAISWFESSEGKKYIERWAWFGA
FPDVTEPWGLENSDGTLNDLGKYYLTL

Enzyme Prediction     

No EC number prediction in I303_06501-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	350	564	1.9e-58	0.9732142857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	3.08e-56	353	564	17	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV90235.1|GH128	1.73e-37	339	565	31	269
QRV75528.1|GH128	8.70e-37	339	565	31	269
CCA70258.1|GH128	5.40e-36	354	567	10	234
QRV92371.1|GH128	5.55e-35	354	565	56	279
QRW18428.1|GH128	2.00e-34	333	565	25	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB0_A	9.48e-24	339	567	6	230	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAY_A	1.85e-23	339	567	37	261	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UBC_A	6.51e-16	354	566	219	438	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	1.20e-24	352	566	316	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001425	0.998539	CS pos: 27-28. Pr: 0.5479

TMHMM  Annotations     

There is no transmembrane helices in I303_06501-t42_1-p1.