CAZyme Information: I303_06114-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_06114-t42_1-p1
• CAZy Family: GT2
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
772	KI894033|CGC9	83565.05	4.3201

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894033:1249103-1253283(-)

Full Sequence      

MRSPIITTPLLGILTLTHTLTSSSVGAQNITQTSSVSFSATPVSTTVPSATVAADTPVPG
QGDYPPVQYLCENGSNTTYCPGVLLQDVQLAGIFPDSKTFVDKPTNGTLNDTLAAFNALG
SNLTVGTMETFVESNFKGEGLDLEQIPIEGFVQNPAILDNISDPIYKAWTSIVNSYWTLL
IRETNESSICNGQCDSSLIPLNHTVVVPGGRYREIYYWDSRWIIEGLLKSELYNYAWNLL
QNMMDFIDLYGYIPNGGRKYYINRSQPPVFVQMLDAYIKVTSNTTILERALPLASAELEW
WANNRTFNYTSPFTNKTVLVAHYAVNNSAPRPEGYVEDYETVTGSSPALNDSAKAELYSE
LATGAESGWDYSSRWCKQPLLNATDNNPALRTLNVKAIIPVDLLSLLSGDHTLLANLYDL
YANSTGGSAPGNNSTISTGNSSSSTASSPAFYHRQQAQLFQDAILDLCWDPAKSWFYDFN
TTSNSRSNVYTPAGAWPLWQNITPNELVNNETKALEFVSGARFLLGKYSGIPSVASLLAT
GLNWDFPNSWPPHVHTTIKAFENLGRHYPNASTLSNLTIPYSQVVNGQLGVEEAELQPQP
ASTIGNVSLQTQEAAGKPWPLALSIEYANRYLGAAFCSWYSTGGAIEGLLTQLPLSELNA
TGTYTAGQSGVMFEKFNATDTDAAGGGGEYTVQVGFGWTNGVVLWAAGEYGQYLPSPTCP
MIPIIEVNGNGNSSVYSNGTTVNGTGPIENSSSGGNATSSLLFAGYRIPRED

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	93	567	3.4e-113	0.8716904276985743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	4.66e-105	93	711	2	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	2.64e-95	84	711	10	545	alpha,alpha-trehalase
224541	TreA	3.42e-61	84	704	61	546	Neutral trehalase [Carbohydrate transport and metabolism].
237326	treA	3.65e-56	72	704	35	530	alpha,alpha-trehalase TreA.
183936	treA	4.09e-53	84	704	52	530	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW44482.2|GH37|3.2.1.28	0.0	27	771	18	761
KGB76251.2|GH37	0.0	27	771	18	762
AFR96750.2|GH37	0.0	27	771	18	762
AUB26705.1|GH37	0.0	27	771	18	762
ADV23702.1|GH37	0.0	27	771	18	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	2.28e-55	95	711	39	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	2.85e-54	95	711	39	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	3.39e-50	82	704	15	496	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	1.44e-48	82	704	15	496	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
5Z66_A	1.48e-47	72	704	38	533	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	6.84e-95	79	719	54	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|A8J4S9|TREA_APIME	1.17e-82	79	714	46	572	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|P19813|TREA_RABIT	7.26e-82	79	718	33	557	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|Q8MMG9|TREA_PIMHY	8.94e-80	62	721	36	582	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1
sp|P32358|TREA_BOMMO	1.50e-79	79	716	27	555	Trehalase OS=Bombyx mori OX=7091 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.290940	0.709030	CS pos: 26-27. Pr: 0.2959

TMHMM  Annotations     

There is no transmembrane helices in I303_06114-t42_1-p1.