CAZyme Information: I303_06029-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_06029-t42_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776		86113.39	6.4116

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894033:1022367-1026225(-)

Full Sequence      

MWSPIKTALLVLSPLIPSALIPNFDKHSSNGTYDGPFTDGGVWSKAFEHAKEVNLTTAVT
GPCQANSGGVPRLDIPGLCFNDGPSGPRYTDFVTQWPSEFTAAASFDRELIEGRARRIGK
EFRGKGINVELGPVTGGPLGRSPYAGRNWEAFTPDPYLSSTLSFLTVRGMQQSGLITCAK
HYILYEQEPVCDGPLDDEGGRTGCEDISSEVDDKTMKELYLPSFAETVRAGTGAVMCSYN
KINGTAACESNDALNRVLKEELGFRGFDFGATHSTVASALNGMDMELPGEYFCKSQAYGQ
RLLQAINKGSIPESRLDDMVQRILTPWYASQQHTNYPRINYQKYDLSDSKEVNGHVWTNE
HVDVRKDNAIYARKVAAESTVLLKNSGVLPLRGIRRIGVFGTDADYPSTLSGCGPDLFCL
VGSKRRYWNGTVTIGGGSGAAYADYIAAPIEAMSLRARQSGIRVDHVLQNDPAHYGSMAW
IAYQSEVCLVFVSLFLVEGWDREHLRLDKKGEDLIKHVEKNCAGEVVVVMHAGGQVIVED
WIDLPKIGAVLFAGYPGQETGNALVDILWGDVNPSAKLPFTMGKKAEDWPKNNIVRDMGK
GHYPVSKFTEGLAIDYKWFDKHDINPRFEFGYGLSYTNFELSGFDIAEMYEKDQDSIQRT
NERFKGERGLYDTLYVARVNVTNVGKVAGAEVVQLYMSFPKSEKDQPPKHLRGYGKKYLE
VGQTTTISFPLRKKDLSIWDVKQQLWKIPHGTFTFRVGTSSRSLPLKLEVDIQTYY

Enzyme Prediction     

EC	3.2.1.21:10	3.2.1.37:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	288	5.5e-49	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.29e-61	72	762	101	755	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	2.66e-49	380	636	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.82e-45	66	729	72	740	Probable beta-xylosidase; Provisional
224389	BglX	6.79e-42	71	405	56	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	2.28e-34	94	325	86	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV75463.1|GH3	1.21e-219	20	765	34	795
QRV90159.1|GH3	5.72e-219	20	765	7	768
CED82386.1|GH3	5.49e-214	38	772	54	812
QRV89392.1|GH3	5.62e-208	19	767	9	774
QRV74685.1|GH3	4.50e-207	10	767	8	774

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBS_A	8.91e-174	29	766	44	797	Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_B Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_C Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_D Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes]
6KJ0_A	2.50e-173	29	766	44	797	Bifunctional xylosidase/glucosidase LXYL mutant E529Q C2221 [Lentinula edodes],6KJ0_B Bifunctional xylosidase/glucosidase LXYL mutant E529Q C2221 [Lentinula edodes]
5JU6_A	1.27e-163	6	767	2	848	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5FJJ_A	2.77e-154	33	767	11	835	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
6SZ6_A	8.62e-151	28	766	3	831	Chain A, Beta-glucosidase [Thermochaetoides thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B0F4|BGLG_EMENI	7.39e-168	29	764	51	808	Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglG PE=3 SV=2
sp|A1D122|BGLM_NEOFI	3.71e-167	33	766	43	763	Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglM PE=3 SV=1
sp|B8NMR5|BGLG_ASPFN	2.04e-166	38	770	60	810	Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglG PE=3 SV=1
sp|Q2U325|BGLG_ASPOR	2.04e-166	38	770	60	810	Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglG PE=3 SV=1
sp|Q0CEF3|BGLL_ASPTN	2.15e-166	42	766	24	730	Probable beta-glucosidase L OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglL PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000290	0.999689	CS pos: 19-20. Pr: 0.8164

TMHMM  Annotations     

There is no transmembrane helices in I303_06029-t42_1-p1.