CAZyme Information: I303_05958-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_05958-t42_1-p1
• CAZy Family: GH88
• CAZyme Description: chitin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
913		103016.28	8.9302

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894033:822074-826241(+)

Full Sequence      

MNPNDPFHDSNSNQRNRLTPSPQPSQYPPSTQSQVYPPQQYQPINYDDGGDMGYGGRMAG
GVEVNGQHMPWVAGEEDDELKPLTSDANASTTSFMPHSPYNRPLNHMPSGNSVGADFMRR
QTIPRRGVTTKKIKLTKGNFIADYAVPRPVSSSVEEKWITGNKSNEFSHMRYTAATCDPD
DFTPENGWRLKTTSYNRETELLIAITSYNEDKILYARTLHNVMLNIRDICNTKASKFWRR
TAEEGRPGWQKIVVALVADGLGPMDKQVLDVLQTIGLFQDGILKKEVDGKPTVAHIFEAS
IFPDRCFYTTQLSIDATPQLVQPHPGDANNLVPVQMIFVLKADNSKKINSHRWLFNALGR
QLNPEICVLLDAGTKPGHKAIYHLWEAFYNNPNLGGACGEIHAMIKGGKKLLNPLVAAQN
FEYKMSNILDKPLESSFGYVSVLPGAFSAYRFRAIQGRPLEQYFHGDHTMAARLGKKGIY
GMNIFTKNMFLAEDRILCFELVAKAKDKWVLQYVKPSKAETDVPEQAAELISQRRRWLNG
SFAASVYALIHFFRLYRSGHGPIRMLFFHIQGLYNFFNLIFSWFALANLWLTFSIIINLV
PAGSNINLFVTAEVTYWVNLVLMWIYMAFLMLQFVLALGNRPKGEKGLYLLTLWVYAVLA
AYLIVCSVILSVVAFKVISIYTDPGNIGQKLGNLFNATNGVLVAAVMSTIGIYLIASFLY
RDPWHMFSSFPQYMLLAPSFTNVLNVYAFCNLHDVSWGTKGSDKAEALPAVSSSKGKDGE
VAVVEEPQRNQDELDESFKSVVQRAVAPYKSDEKEEKPSMDDENRTFRTRLVGSWLLSNA
ALAISIQTLNGLDTTKQLVEKYALKFNTVELQNKQQFYFQALLWATFGLSMVRFLGCLYY
FFARQMGRCCRRN

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	208	388	1.8e-63	0.9877300613496932

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	3.23e-92	208	388	2	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	4.91e-91	203	544	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	1.40e-32	132	206	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	4.51e-28	337	665	115	400	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	2.52e-16	365	539	203	372	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB25429.1|GT2	0.0	16	913	22	931
AFR95603.2|GT2	0.0	16	913	22	931
AAW43575.3|GT2	0.0	16	913	23	920
UOH82531.1|GT2	0.0	16	913	22	895
KGB79519.2|GT2	0.0	170	913	1	756

PDB Hits     

I303_05958-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J9VMX7|CHS7_CRYNH	0.0	16	913	22	931	Chitin synthase 7 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS7 PE=2 SV=2
sp|P30598|CHS1_USTMA	0.0	76	913	84	919	Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS1 PE=3 SV=3
sp|Q00757|CHSB_EMENI	2.26e-298	126	900	143	903	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|P30602|CHS3_EXODE	1.65e-295	130	846	135	852	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2
sp|P54267|CHSG_ASPFU	7.41e-293	126	900	138	898	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

Start	End
579	601
614	636
651	673
693	715
730	752
831	849
881	903