CAZyme Information: I303_05711-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_05711-t42_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859		94790.78	6.5380

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894033:123530-126870(-)

Full Sequence      

MGDTANTWLKPDFDIEQVLANLQTLDRVHLLRGGNGFSSAKLLNHGIPPVRMVDGPSGCR
GTVIYNGTRANCFPCAVGIGSSFDLGLVKDMAKQLAREAHAKSSHILLGPTLNIIRSPLA
GRGFELFSEDPLLVGKMGATYIKSLQEEGVANEQEFNKHTAETVVSDRALREIYLEPFRI
AVREGDPWSTMMSYSKIHGVHGCDSKFLIDDVLRKEWGYGGTVISDWYGTHSTSRSIEAG
MDLEMPGPSIWRTDAQVLSHLEANMIDKKAIEKCVRNMLKLVKRAIQSKIPFEGPEVALD
TPEIRALLRRAAANAVVLLKNDLQVLPIGNNKHRKTPSKIAVFGHNAGQHFSSGGGAASV
PLETFSNSPLSGIQAAAQEISAEVTYSLGTVAYQYVPVADRYLSVPSRDGVSGVARIEFW
SEQPHDEWKTTKGNIVIEKPSDHDMISPTARCFMHDGVPDHIGKDGHYVRFTSSFIPDQD
GDWRIGLASIDRANLFVDGQLVIGYDDNLKDGTMFFHFCHEERSCVLHNLKKGQKYQVEL
RCWDTTKLHSLPVKMPAGFSIGLVRELDPQGAIDEAVALAQTSDECIVMVGLNKEYESEG
YDRQTMRLPGTSDKLVEAILAVRPDAIIITQSGMAVEMPWAEKAATILHAFYGGTSLGDG
LADVLFGRVNPSAKLPMTFPKRIEGSSSYPHFAHLSPSHKQVVYAEDIYVGYRLLDRSPE
RIRFPFGHGLSYTTFAYSDLVIEAASEFGQFTVKFSIKNQGSLFGAESAQVYIRPLSSAL
PRPYKELKGFTKVFLTPHSSAQAKVNLDRSAFAYWDDREDGGSWIAEQGEYEVIVGASSL
DLRLKAMVTLDRTEIWRGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	45	246	7.8e-51	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	5.41e-58	46	349	59	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	4.53e-53	73	843	120	758	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.19e-43	560	712	68	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.87e-33	46	281	65	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.05e-27	45	808	92	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDZ97665.1|GH3	2.09e-220	15	859	6	837
BAL27551.1|GH3	3.25e-219	9	859	1	847
CDR42254.1|GH3	5.87e-218	13	859	9	851
UPK92097.1|GH3	2.25e-195	1	859	1	846
UQC80364.1|GH3	1.65e-190	14	859	2	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.50e-168	13	859	4	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.63e-164	13	859	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	5.09e-112	14	853	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.88e-91	26	851	16	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.04e-84	46	845	50	708	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	6.80e-186	11	859	2	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	7.34e-185	14	859	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	7.34e-185	14	859	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	7.56e-185	11	859	2	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	5.78e-184	13	859	4	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I303_05711-t42_1-p1.