CAZyme Information: I303_05618-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_05618-t42_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628	KI894032|CGC12	72653.36	7.1468

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894032:1958766-1961156(+)

Full Sequence      

MPRLRVTRSTIVLAVAGLLFISFFIFSPGPKYDLNFDDVDLDAASTDSSLSGAALDKVRN
QQKALNQWLSNTDPTLPQGLEYTKDGYVRGWEKIHELLKKGGLKKKDQKRLRAIGEQHPI
IELMKQGEKKWTDLLDRQSKTLPQAVTEYRRRYGRAPPKGFDQWWQFCKRNQVKIVDDYD
QIFRDVEPFFALSPKMFNDRVNELTETQHVAHITLSPDGPSSLFGQRAHSARPRLLFQLL
EPIAQYLPKELTFTLSDHDLGSWILGDDQKQAAYAAIQSGTYLSETELKILEKREGRKPV
KGLVSACPEESPGWQRGIAVRDGLPLDEFNPSADESSFIADPLQTYDFCYNPSLLKFHGS
LSFDFCRETILRPIFQLSKFVRNPEFLTTPLEAYDNFTSAEGRKKYVPWEQKTISKLFWR
GSTTGDSYSKRKDYTWHQSHRPRLALMTQEQKGLKDVWVKSRRGRDWEKESWSISRLNSA
YMDVGLTGGPHQCKKEDGTCDEMAEEIEFKDRVRPEDAAKYKYVFDIDGNGWSSRFHRLV
MSGSVVVKATIYPEWMTDWMTPWVHYIPCKIDYSDLYDIMSFFAGPPDGRVGGHDELAQQ
IAEQGKKFGEEHWRWEDMQAYMFRLMLE

Enzyme Prediction     

No EC number prediction in I303_05618-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	371	628	4.8e-67	0.876

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.31e-26	401	628	72	248	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.35e-14	400	628	147	318	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACZ51497.1|GT90	0.0	1	628	1	622
AEG78614.1|GT90	3.13e-313	2	628	3	622
AAV28771.1|GT90	4.45e-313	2	628	3	622
ADV24227.1|GT90	4.45e-313	2	628	3	622
AAS92531.1|GT90	4.45e-313	2	628	3	622

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	3.36e-13	474	628	196	337	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	3.12e-10	401	626	199	372	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.70e-92	115	628	149	651	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	2.19e-12	474	628	224	365	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	2.19e-12	474	628	224	365	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	2.91e-12	474	628	224	365	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|B0X1Q4|RUMI_CULQU	5.36e-11	451	626	218	382	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999795	0.000239

TMHMM  Annotations     

Start	End
9	26