CAZyme Information: I303_05137-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_05137-t42_1-p1
• CAZy Family: GH47
• CAZyme Description: chitin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1449	KI894032|CGC2	161462.70	6.3602

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894032:585956-592039(+)

Full Sequence      

MPASSRKPPPNPQPFLTTSAYSHSTSGHSQSHSSASPGLSRGPSPAPPYDNRQSNSNDAF
LGARALAYGPSGPAHAQRSEMSYVPPYASPPPQPALGLSQPVSQRLPFFEAALARSRGQQ
LPPDAEHSAARYGYNQPLPSYLPPPDPNHPELAVGFTQSNTVRYAAVGRELSRSPSPIPD
ENFEQGYRGYDYAGENDIEKALLEQEDLDRNQWQGRDEKLWSEKVMFQMTEDGGDISVPP
MRIAPGVSGADIPSIHIRGPTNSTLVSLQEGDLAASSTQHFGPAPTGRVGRRTHNAAGHR
RIKQSATLDENGFFAVDMPIPTRLAQFLPVKGVEEQKSTRYTAVTTDPDDFPTSGLRLRQ
NMFDPPRQTELFIVITMYNENAELFCRTLYGVMKNVAHLCGRKNSRVWGKDGWQKVVVCI
VADGRKAVNPRVLDCLAALGVYQEGAMTNKVKDRPVTAHVFEYTTSFALDADLHFKYPDK
GIVPCQIIFCLKEKNAKKINSHRWFFNAFAPLLSPNVCILLDVGTRPAPKSLYYLWKAFD
LNSNVGGACGEIATFKGKTWRSLLNPLVAAQCFEYKMSNILDKPMESLFGYCSVLPGAFS
AYRYLALQNNPDGTGPLASYFQGENLHTGKADTFTANMYLAEDRILCFEIVAKKKANWVL
KFVKSAVGETDCPDTIPEFIAQRRRWLNGSFFAAVYSLIHVAQIWRSDHSLLRKLALMLE
FAYNALNLLFSWFSLANFYIFFVILTRALEGEAFNIPRIDILNSIAQYGYLGALVACFIF
GMGNRPQGSPWKYKATIYFFAVLTTYMLVAAVLCTVQAIKNFDSPIFSRMIVSLISTYGI
FIASSVLALDPWHLLTCFVQYILFSPSDHDLSWGTKGSDTVQESDLGAVQGIGKHVEVEL
VSAQQDIDIAYQDALDNIRLKGARVDEDKKKDNSEQAQKDVYANFRTNLLLCWSLSNALL
ASVILSGSTTGTFDSGGNSRTGIYMLIILNIRKCGHAVSHLITQSATQLLRYVQGKEASS
FDSNESYSLSTIDLTFETLASLAQDMINTIPFHIVPKHWLRLYTDVAILQSIKDVVMNRR
EGDGRATDELWSKAVRRLDMAIIVAGAIGNKRKDWVIELIEIIQAKFELANRASDLEGMR
VTKKPRIEQPAVDVDPLLFAPKPIPVLQEPPDIESYLENHLDHPFIVRGYLNGLNASPRW
PACERWASHEYLTEAVGLGRVVPVEVGKAYDDESWTQKIIPFTDFLRRAGFRDSFGTPLE
EDATLPDSPLYLAQYGLFDQFPTLEKDMSFPDYVWSNPPSPSNYPSYVAPQNVDGLIVNV
WVGSGNGEIISPAHTDPYYNCYAQVLGHKRVWLAPPECAPFMCAYGEGQIEEEGLAEQYM
TNTSKIPILRPINHFLSLKADYPEFFEHVWPESLEAVLEPGDLMVMPPGWWHAMRGEGKG
PAWSVSMWY

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	377	539	4.8e-76	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.10e-108	377	539	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	2.55e-90	373	693	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	2.67e-28	488	813	115	402	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404504	Cupin_8	1.47e-26	1184	1449	14	245	Cupin-like domain. This cupin like domain shares similarity to the JmjC domain.
400626	Chitin_synth_1N	1.49e-22	311	376	6	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV25813.1|GT2	0.0	45	989	31	969
UOH85558.1|GT2	0.0	45	989	31	958
KGB79143.2|GT2	0.0	45	989	31	977
AFR98718.2|GT2	0.0	45	949	31	928
AUB28903.1|GT2	0.0	45	949	31	928

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F4M_A	1.73e-26	1171	1449	9	234	Human JMJD5 in its apo form. [Homo sapiens]
6F4P_A	2.81e-26	1158	1449	17	254	Human JMJD5 in complex with MN, NOG and RPS6 (129-144) (complex-1) [Homo sapiens]
4AAP_A	2.21e-25	1162	1449	5	238	Crystal structure of JMJD5 domain of human Lysine-specific demethylase 8 (KDM8) in complex with N-oxalylglycine (NOG) [Homo sapiens],4AAP_B Crystal structure of JMJD5 domain of human Lysine-specific demethylase 8 (KDM8) in complex with N-oxalylglycine (NOG) [Homo sapiens]
6F4R_A	2.38e-25	1158	1449	17	254	Human JMJD5 (N308C) in complex with Mn(II), NOG and RCCD1 (139-143) (complex-3) [Homo sapiens]
6F4N_A	2.53e-25	1142	1449	20	270	Human JMJD5 in complex with MN and 2OG. [Homo sapiens],6F4N_B Human JMJD5 in complex with MN and 2OG. [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J9VWT0|CHS6_CRYNH	0.0	45	949	31	928	Chitin synthase 6 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS6 PE=2 SV=2
sp|Q99126|CHS3_USTMA	1.06e-274	278	1015	285	1029	Chitin synthase 3 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS3 PE=3 SV=2
sp|Q99127|CHS4_USTMA	8.05e-246	311	972	225	907	Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS4 PE=3 SV=2
sp|P87073|CHS1_PHYB8	1.97e-244	276	995	84	829	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|J9VGT6|CHS8_CRYNH	2.21e-239	171	989	184	1006	Chitin synthase 8 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS8 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

Start	End
723	745
765	782
797	819
826	848