CAZyme Information: I303_04645-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_04645-t42_1-p1
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413		43947.54	5.5280

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894031:1346576-1348039(+)

Full Sequence      

MITTPLLSLFLLLPTLALGGHNDRMDIRSHARQRNHARAAALQESESHLLRREFHDAVEH
KMARKLARAGMEFAKRKADGSQCRPRNATTPTTLSRSVTSTATSTVISSSSTSTDAATTT
SSTDQQQQQQQTTASSTEQQATSTSSADNSAATGQALVSNPTSYSGHTPNGNKAGVSAGD
SLGWLSGKLGWWYDWSATPSGSCGNAVAVPMIWGGGTADGDDASRLAAFKSMDYVPQYII
GFEEPDCAAGSGSAGMDVGTAISIWNQYVVPKGEAGSILVGPSMCKQAAESGWLGPFMDG
VTRKPDIMNIHVNKNSAAGIYADIDHYYNTYGLPIWVTEFACVDDSTSFIPCTDQSEIDS
FIHTAVDIFESDSRIAGYAYSNGYGLGDVWPMVSNGQLTASGQTYLNALSKYH

Enzyme Prediction     

No EC number prediction in I303_04645-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	186	405	8.8e-52	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	1.94e-51	185	405	14	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
PNP47955.1|GH128	2.61e-78	168	413	7	254
UKZ69748.1|GH128	1.47e-77	168	413	7	254
QYT06237.1|GH128	3.48e-77	168	413	23	270
UKZ58231.1|GH128	4.40e-75	168	413	23	270
UKZ94447.1|GH128	4.18e-74	168	413	7	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UBC_A	7.81e-102	167	413	197	444	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UBD_A	1.95e-79	168	413	29	276	Chain A, Glyco_hydro_cc domain-containing protein [Trichoderma gamsii]
6UAX_A	3.70e-17	166	408	88	345	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UAQ_A	2.93e-15	171	380	23	234	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	7.30e-15	171	380	23	234	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	6.04e-14	175	407	304	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000381	0.999616	CS pos: 19-20. Pr: 0.9736

TMHMM  Annotations     

There is no transmembrane helices in I303_04645-t42_1-p1.