CAZyme Information: I303_04129-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_04129-t42_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432		48887.80	5.2842

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894031:3368-5048(+)

Full Sequence      

MVLQITEDNRQSASALFSADGFDELIPPPAFDYRSYELDNAEAESKLALLIEGMTKVEDK
TGRFVYQLPDGRIIDTCTYHRWEWPQAIGMNGLFDYYHLKSSLDPSSPVAENALNLMKEW
YYQRTSEGIPTKNINSMAVMYSVACLLDLDRRRGPGSVLEEEWRQRFEVWVDEWAEWIMY
ELPRTAQGGFQHVTFRLANEGQLWDDTLMMTVIPLTKIGLLLNRPHYIEEAKFQFLLHTQ
YLMDEVSGFWYHAWKFDSSAGSSGTHSSNALWARGNCWITLAIPMFIELTGLAPSDPVYR
MLVSTFHRQVDALIPLQDTASGLWHTLLDDPSSYVETSGSAGFVGGMLMGIRLGLLDRRT
YLDTAISGLKACLAQVTPTGQVGNVSKGTPAGKDRKFYKGIPRMGMVYGNSLLIVALVQW
MRLNQRDAGTRI

Enzyme Prediction     

No EC number prediction in I303_04129-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	78	422	1e-87	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.47e-77	54	423	8	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	2.79e-67	61	423	6	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW41249.1|GH105	7.69e-113	37	426	38	456
QNT06788.1|GH105	6.35e-112	35	422	9	369
QRV22900.1|GH105	2.55e-111	49	422	23	369
KGB75254.1|GH105	7.17e-111	37	425	39	453
AUB22466.1|GH105	9.53e-111	37	425	37	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	1.57e-105	40	422	5	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3PMM_A	7.11e-92	43	422	23	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	2.74e-91	43	422	22	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4WU0_A	1.77e-12	183	356	110	283	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	1.86e-11	227	398	225	387	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	5.02e-41	82	426	29	341	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	1.54e-10	204	382	201	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000001

TMHMM  Annotations     

There is no transmembrane helices in I303_04129-t42_1-p1.