CAZyme Information: I303_04117-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_04117-t42_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520		58996.84	5.8775

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894030:2217086-2219070(+)

Full Sequence      

MVRTIDQLARSKKLEIRVHKNGRHLVSGPENEPFFWQADTAWEIFHRLEEDEVKLYLSKR
AQQGFNVIFAVLFAEHGGVTLPNRKGEWPFHPKNAVGDKYYPDVFRPNEKYFDYVDWVID
YAASVGIRVAIQPVWGNYVAGVYHRIDHYFDNVDAAKAFGEFSGRRYPFLPYLNGGDVHR
YWFDDASFNAREGKPTRGSGIKVIDYGPVFEAFAEGIIAGEAEHRHDGSSSFIAFHPTAS
WLPDTPLPYASHLFPHSKWLTIDGIQSGHTCCYKYPPLSDPSIGTLNWFHAQDSVDLVRE
MYARSTEDKSLRPVIDLEPHYESTHYNFDPAKEQWKASNIRQGAWQAVFAGAAGVTYGVN
SVWQMNNLESTSHPPIPHRTVSAANWFDELDLPGATYVSFITKWITSRPTFFNRIPDQSI
ILSDTFDRPSDVDDYDGKDAQVISGTRDTGGKWLAVYTPMGRNFILDTTGLAGAKLEAVW
FNPRTGQEVPDGEVKREKIEVVPPSAGSDDHDWIYYVQAV

Enzyme Prediction     

No EC number prediction in I303_04117-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	16	514	2.3e-86	0.9902912621359223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	1.16e-90	21	408	1	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	1.75e-18	415	514	1	88	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KNX49908.1|GH140	0.0	1	517	1	517
KAE8421181.1|GH140	1.10e-96	21	520	34	511
KAE8313632.1|GH140	4.21e-96	21	520	34	510
KAE8156220.1|GH140	4.21e-96	21	514	34	504
KAE8361514.1|GH140	8.60e-96	21	520	34	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	4.02e-37	18	487	20	414	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	9.46e-36	18	487	20	414	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	2.63e-31	12	487	27	430	Chain A, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

I303_04117-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I303_04117-t42_1-p1.