CAZyme Information: I303_03774-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_03774-t42_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610		66924.37	6.9944

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894030:1317510-1320203(+)

Full Sequence      

MSDKPLPTPPYSLVDENQTQGGPSRRPSYTSTQTDSYLRKADEEAELAYDDLLSNAHFEK
STGKLKLDIDGKDVHDLAESAGLKEAEGVYGDSDEDFTSSIAAQQPRVPRLNILILIVGS
RGDVQPYIALGMRLAEDGHRVRLGTHKEFRDFVREASSRKVEFFDIGGDPRELMAYMVKN
PGLIPGWKSLKSGDVGKNTKMLKEILAGTFRACVFPDLETQIPFSANAIIANPPCFGHIH
VAEALGIPLHMSFTMPWSPTTAFPHPLVDLQFKTKGKGKDKDVSEEPSPQTSNYVSYALA
DHLTWLGLQRVINKFRCKTLGLPALSSHSGTGVIHRLKIPYTYCWSPALIPKPKDWKSNI
DISGFYFLDLSTEYTPPPDLAKFLASGPAPIYIGFGSVPVKDPVKMSQILLEAVRKAGVR
VLISAGWAGLGGAESSDDVFLLGNVPHDWLFKHVSAVCHHGGAGTTAIGLANGRPSIIVP
FFGDQVFWGNMVHRAGAGPEPIPADRLNVENLTMAIQQALSKETLTAAGRMGEIIRSEDG
VQRGVDSFYHKLPLDRMHCEVRPDLVAEWYYESLDIRLSAFAAATLIKSGRLKSSSLEPL
RSAEYRTSRV

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	293	546	2.7e-50	0.5863874345549738

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.11e-72	111	548	1	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.12e-43	113	547	4	394	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	4.07e-25	113	264	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	5.80e-09	116	546	1	384	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW24985.1|GT1	5.10e-192	109	607	155	644
CCA73033.1|GT1	7.32e-191	107	607	112	596
QRV87000.1|GT1	4.43e-187	109	607	168	657
QRV96491.1|GT1	1.11e-181	109	607	141	630
QRW15356.1|GT1	1.26e-181	109	607	107	598

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	8.64e-82	115	556	24	443	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.48e-81	115	556	44	463	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	1.73e-31	111	538	1	385	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	5.41e-28	111	538	1	368	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	2.04e-24	111	546	1	393	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	1.11e-138	83	571	128	601	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	4.69e-134	108	553	190	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	6.72e-84	115	556	999	1417	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q5B4C9|ATG26_EMENI	5.00e-81	82	552	869	1313	Sterol 3-beta-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=atg26 PE=3 SV=1
sp|A2QNQ5|ATG26_ASPNC	2.94e-80	111	565	897	1327	Sterol 3-beta-glucosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=atg26 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000001

TMHMM  Annotations     

There is no transmembrane helices in I303_03774-t42_1-p1.