CAZyme Information: I303_03748-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_03748-t42_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645	KI894030|CGC12	73749.62	6.5560

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894030:1244912-1248089(-)

Full Sequence      

MPRLLKALIVSSALLFLFALHHFLPPSTLTQIRQSRPGILSSSSSSSSSSNRRSPQSSLY
SVKRPPISGGWSRNPYEESGLLIDHRGLTHWDREDKHKLHPIKGLIERGKELAEKQKRKI
ESIRTIEDAVDDYVDSFGMKPPKGFDYWYKFTQSIKPNPPPVPSLIPLAHRPFLSFLSLP
VEILRERIEIVRSKGAIFTFTFVPPGQGDEGTACDSSQNWVPADYHKRGKGRVIIDGVEA
WGWRCNNKLTLLLPILSLLPDDLFTMDPPLEIAFSSDDGPRGMVHNTFREKAESLAKSGK
TWPQAQLDKAEQSMRWTYGWAWSCPDDSPLKTRATDLVLNDLPQPDYLTGGQVEKSFIAD
FDRSADYCSDPELMGYHRAAVEMTPVVATCKTMWNSDIVGVPLDGVFEKVPYVKWEDKSI
SKAFWRGSATGLFHSRKTPWRSSQRERLHFFANNETSLQDTVSVLLPNGEIGEYQNEKLN
DWLDVGLSGVPSQCDQADGSCDDMLREINFMGRVRKEDSLKYKYVIDVDGNGWSSRFRRL
LSSNNVVLKSTLYPEWFHEMLIPWYHYVPIKLDYSDIHDIMAFFNGSPDGQVKGHDELAR
EIAQNGWEFVENRWRLQDMQSFMFLLILEHWRMMSEDRQAASYDP

Enzyme Prediction     

No EC number prediction in I303_03748-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	379	634	1.9e-65	0.912

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.25e-24	383	637	30	256	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.33e-16	376	630	99	319	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW41853.2|GT90	9.80e-259	1	643	1	629
AUB22757.1|GT90	3.99e-257	1	643	1	635
AFR93241.2|GT90	3.99e-257	1	643	1	635
KGB74299.2|GT90	4.79e-253	1	629	1	621
UOH81501.1|GT90	2.03e-248	1	629	1	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	8.46e-14	439	634	206	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	2.62e-13	439	635	171	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	4.20e-84	100	644	152	666	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	1.85e-13	368	633	146	388	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8T045|RUMI_DROME	4.58e-13	439	634	218	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	5.45e-13	385	635	146	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	9.67e-13	385	635	146	371	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998109	0.001921

TMHMM  Annotations     

Start	End
7	24