CAZyme Information: I303_03266-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_03266-t42_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392		44649.10	5.2372

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894029:2368379-2369915(+)

Full Sequence      

MSSQLTLTTEKAEQLIRVLTDGLVNIKDEEGKFLLHLPNGFAVNTKTWDGWEWTHGVAHT
FLTHVSAEPAKYSVKTVLDWFEYQYKATDGKGCPKNINTMAPFYSLICLMQDGKTNDPRW
SAWVDEWAEWIMTDLPRTEERGFQHMNYRSVHYNNLWDDTLMMTVIPLAKIGVVLDRPQY
IKESIYQFLLHIRYLMDPVTGLWYHGWCFTPDGKPTQFSKNPNVASYGHHFSAALWARGN
SWITLAIPMLLEILQDKLEKDDPVRLTLISVLKRQIDALIPLQDPQMGLWRTLLVDKETY
VETSASAGFAAGIYMSLRLGLISGDQYRLTADRALQGVVEQIDDSGEVGNVSYGTGVGLD
LQFYKDIPITPMPYGQALAMAALVEWERLTTQ

Enzyme Prediction     

No EC number prediction in I303_03266-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	44	388	1.3e-94	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.14e-85	46	389	29	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	5.35e-72	25	389	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW41249.1|GH105	1.17e-153	2	392	32	456
ADV19987.1|GH105	4.40e-153	4	389	37	451
AUB22466.1|GH105	6.46e-153	5	389	36	449
AFR92981.1|GH105	6.46e-153	5	389	36	449
KGB75254.1|GH105	3.21e-151	4	389	37	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	3.91e-109	8	388	4	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	4.98e-101	10	388	24	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	8.24e-100	13	388	28	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3K11_A	1.10e-12	154	369	197	392	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	3.33e-35	51	385	29	334	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	8.63e-07	157	353	201	380	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I303_03266-t42_1-p1.