CAZyme Information: I303_03241-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_03241-t42_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823	KI894029|CGC5	88819.76	5.7506

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894029:2291019-2293931(-)

Full Sequence      

MTFDPDTIAAQLTLEEACTLLHGQDFWRLNGVPRLGVPNGLKLSDGPNGARATRNVADST
QSACFPAGVCLAATFDQEAARRIGNAIADECRSKSASAILGPTVNIHRSPLGGRNFESYS
EDPVLAGYIASGYIKGVQEKGIAATIKHFICNDSELDRRTMDVSVSEKALREIYLRPFEI
AVKHAKPRSIMTSYNKVNGEYVSDSARLVNGIIRKEWGATDVLVVSDWWATYSTEKAVLA
GLDLEMPDSYARGSGQLIQAAKKSPQLAAAARERARTVLQFIKDAGGYDLPPELPELADD
KAEHRDLIRTVGASGTVLLKNKDLALPLSTSLPVAVVGLFAKKALIHGGGSASLESHHRV
SPFDGIAEVFPRAIHVPGPNAYNYCPVLEQGVATRPDGQSGMVVEFFNPNGDLVETRSLD
GTFLTALDRYPKGLEPGWTATMSFTLRPKTTGRHVLSMASCGIAELSVNNQTICTTVPKP
EDPNLFLMLALHKIAKKAAYEFEFGKGYEVKVNYKSNKDKIFATELPANGIHIGFSEALD
EDTLIQDAVEAAIKIGTAIVCVGNNPDYETEGFDREDLFLLGRQNELVERIADSDSKVIV
VVHAGSPIAMPWLDKVDAVLYTWFPGQELGHALADVLSGAVNPSGRLPVTFPKRIEDNPS
FGNFPGANEKIVYAEGSFVGYRHYATKSIPTLFPFGFGLSYTTFSVTNLSIAGIESFGPV
SSLTVTATVENTGKVAGRHAVLFFVSPPAGSSRPLISLEGFTKTNLLQPGEREEIGISLQ
QDAFSHWVGELDGRWELEAGKHVVRILADAGSLSGPSQIVTIQ

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	247	3.4e-62	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.09e-55	61	806	116	750	beta-glucosidase BglX.
224389	BglX	6.82e-53	24	342	47	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	9.02e-51	528	701	64	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.03e-35	31	763	75	727	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.74e-31	65	263	88	298	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB26217.1|GH3	2.69e-279	107	806	3	701
AFR96312.2|GH3	2.69e-279	107	806	3	701
KGB75246.2|GH3	1.11e-251	3	665	5	623
ABU57034.1|GH3	5.33e-189	6	806	17	815
ABQ91838.1|GH3	3.07e-188	6	806	17	815

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	9.11e-161	3	806	4	821	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.35e-157	3	806	4	821	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.71e-130	1	806	1	653	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.35e-105	12	806	12	648	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.84e-105	8	813	7	705	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CA51|BGLI_ASPCL	2.52e-178	3	806	4	815	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	3.44e-177	6	819	12	836	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	4.80e-176	6	810	3	799	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	7.05e-175	4	806	5	816	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	9.94e-175	4	806	5	816	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999456	0.000589

TMHMM  Annotations     

There is no transmembrane helices in I303_03241-t42_1-p1.