CAZyme Information: I303_02830-t42_1-p1

Basic Information

• Species: Kwoniella dejecticola
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella dejecticola
• CAZyme ID: I303_02830-t42_1-p1
• CAZy Family: GH15
• CAZyme Description: cytoplasmic protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
503		56734.15	6.7888

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KdejecticolaCBS10117	8724	1296121	122	8602

• Gene Location: location=KI894029:1152849-1154826(+)

Full Sequence      

MGLFDKFKDQFHSSSPSYDFPSAHQPIPLGPNAVFRYRQQRGVNLGSWFSLERWICESVF
RNAIQPGQSDFDVASGRDAKRVLEEHWDTWIGDDDWKWIRDKGFNSVRIPISYYHLCGPL
PEVLKGTDFEPFHHIFEGAWGRIKRAIETAGYHGLGVLIDLHGAAGAQNNDAHAGMSKGK
VGFWDKHSNLASTSLALRFLASELCHIPHVVGLELLNEPANNSKLQGWYKSTIEEIRSIV
PSDFPLYISDAWDTGHYAWFVGQHVDTQAQNSVVLDHHLYRCFTDQDKNKSGYQHASELR
GQFQSDLKGQSDAAKRSMVVGEWSASLDPHSFGHVPDGEKDAQRREFVKAQLELFEAHTA
GYWFWTYKKGDGWDAGWSARDASRAEILPSWVGGKMFKGPPPQGVKEHEQNQAHNAHTGY
WASHGGSPDPTVFAPGFSQGWDDSLLFLSHPSGTSQIGFISQWMGKRRMEYEAHSGKKLG
KATWEWEHGFKQGVEASLRVCTY

Enzyme Prediction     

No EC number prediction in I303_02830-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	83	372	8.3e-116	0.9964664310954063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	9.60e-28	32	391	10	384	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	4.22e-05	99	239	33	157	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW45154.1|GH5_50	3.16e-271	1	501	1	496
KGB80314.1|GH5_50	3.68e-270	1	501	1	496
ADV25348.1|GH5_50	4.27e-269	1	501	1	496
AFR99083.1|GH5_50	2.34e-266	1	501	1	496
AUB29314.1|GH5_50	2.34e-266	1	501	1	496

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2PB1_A	9.05e-29	30	397	3	393	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
1EQP_A	1.13e-28	41	397	10	387	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	1.54e-28	41	397	10	387	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3O6A_A	2.26e-28	30	397	2	392	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	2.29e-28	30	397	3	393	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74799|EXG3_SCHPO	6.26e-70	29	489	3	444	Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg3 PE=3 SV=1
sp|P38081|YBQ6_YEAST	1.45e-50	29	495	35	496	Uncharacterized glycosyl hydrolase YBR056W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YBR056W PE=1 SV=1
sp|Q96V64|EXG_BLUGR	5.13e-34	35	389	32	404	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	1.55e-33	41	397	43	411	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	7.54e-33	41	397	43	411	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000081	0.000000

TMHMM  Annotations     

There is no transmembrane helices in I303_02830-t42_1-p1.